THE CONE OF EFFECTIVE ONE--CYCLES OF CERTAIN

GH-703Power RiveterMAINTENANCE MANUAL1224 East Warner Ave, Santa Ana, CA 92705 Tel: 1-714-545-5511 Fax: 1-714-850-6093 G H-703Power RiveterThe Cherry® GH-703 is a pneumatic- hydraulic tool designed specifically for the most efficient installation of commercial fasteners. It weighs only 5 pounds and can be operated in any position with one hand. It has a full 3/4” rivet setting stroke and a rated pull load of 2000 pounds.The GH-703 riveter operates on a wide range of air pressure, with 90 to 120 psi providing the maximum efficiency. At 90 lbs. air pressure, the GH-703 has a decibel rating of 80dB(A) and consumes 3 CFM at 20 cycles per minute.A mandrel catcher bag may be attached to eliminate costly cleanup.The GH-703 comes equipped with nose-piece 728A9-6 to set:N Rivets - 3/16” diameterQ Rivets - 3/16” diameterCherrymate® Rivets - 1 /4” diameterThere is also a spare nosepiece, 728A9-4, included for setting:N Rivets - 1 /8” diameterQ Rivets - 1 /8” diameterCherrymate® Rivets - 3/16” diameter Warning: Approved eye protection should be worn when operating, re-pairing, or overhauling this tool.MANY OTHER STYLES AND SIZES OF COMMERCIAL RIVETS CAN BE SET WITH THIS TOOL. REFER TO THE NOSEPIECE SELECTION CHART ON PAGE 8 FOR APPLICABLE PART NUMBERS.1H o w t h e G H -703 O p e r a t e sWhen the tool is pressurized by hooking up to an air line, the valve spool is forced upward. This movement aligns the port in the spool with the lower port within the handle, allowing air pressure to enter the bottom port of the power air cylinder. This forces the air piston upward.When the trigger is depressed, air bleeds out from behind the trigger, lowering air pressure against the bottom of the spool. Air pressure is now greater on top of the spool, forcing it down. This action shuts off the air path to the bottom of the power air cylinder, and simultaneously opens the upper port, allowing pressure to enter directly into the top of the air cylinder. This forces the air piston downward.The air piston is connected to the hydraulic power piston with a common connecting rod. When theair piston is activated by changes in the air valve, it in turn activates the hydraulic power piston. Air pressure also travels up through a port in the handle to enter the rear of the head cylinder. This air pressure forces the return of the head piston to its full forward position.The center area of the handle (that part held by the hand during riveting) contains the hydraulic system. The hydraulic power piston has its own cylinder containing the fluid which is pressurized by the downward travel of the piston. This forces the fluid up through the handle into the front of the head cylinder, thereby exerting the force needed to push the head piston back in a full 3/4” rivet setting stroke. This same fluid then returns to the power cylinder by the forward action of the head piston under air pressure.SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.23PART LIST FOR GH-703 RIVETERREF. NO.PARTNUMBERDESCRIPTIONQTY. REQ.1703C2703C2 HEAD CYLINDER 12P722 O-RING,(.816,.676,.070)23P860 BACK-UP RING, (.794,.688,.053)14703B3 HEAD PISTION 15P872 O-RING,(1.130,.924,.103)16P868 BACK-UP RING, (1.129,.957,.103)17P724 O-RING, (1.129,.898,.070)28P112 O-RING,(.504,.364,.070)29703A5 SEAL TUBE110P109 RETAINING RING (EXT. .375 DIA)211703B4 CAP112P880 RETAINING RING (NON-STANDARD)113703A13 DEFLECTOR FITTING 114530A16 DEFLECTOR PIN 115P126 WASHER116P90 BUTTON HEAD SOC. SCREW, 10-32 X.375 LG117P838 O-RING, (568,.362,.103)218P115 BACK-UP RING,(.551,.375,.088)219P727 O-RING,(1.318,1.112,.103)120700B93 PACKING PLUG121P731 BACK-UP RING,(3.365,3.125,.120)222P730 QUAD RING,(3.387,3.109,.139)162700A115 AIR PISTON SUB-ASSY.23700A110 WASHER, AIR PISTON 124700C106 AIR PISTON125700A111 WASHER, AIR PISTON 126P737 CONELOK NUT127P725 O-RING,(3.129,2.989,.070)128700C112 HANDLE BASE129P735 RETAINING RING, (INT. 3.500 DIA)130700B109 BASE COVER131P736 RETAINING RING,(EXT. 2.250 DIA)132703A33 TRIGGER ASSEMBLY 133P223 O-RING,(.285,.145,.070)134703A11 HANDLE135P734 RETAINING RING, (.689,.599,.025)136700B7 POWER CYLINDER137P833 O-RING, (1.068,.862,.103)238P739 BACK-UP RING,(.624,.518,.053)139P294 O-RING, (.629,.489,.070)163700A8 POWER PISTION & ROD SUB- ASSY.40702A11 PISTON ROD CAP 141700A9 POWER PISTON 142702A12 PISTON STOP 143700A10 POWER PISTON ROD 144P653 O-RING, (.691,.551,.070)445700B73 VALVE SLEEVE 146700A67 SPRING147P829 O-RING,(.504,.364,.070)364700A15 VALVE SPOOL SUB- ASSY.48700D15-2 VALVE SPOOL 149700A18 FILTER150700A69 METERING SCREW 151P834 O-RING, (.816,.676,.070)252700A16 VALVE PLUG 153700A17 MUFFLER154P279 RETAINING RING, (INT .906)155700A22 GASKET156P832 O-RING,(.379,.239,.070)157P27 SOC. HD. CAP SCREW, 8/32 X 1/2458*670A20 MANDREL CATCHER BAG 159*P948 HOSE 160*703A22 HANGER161*P881 BUTTON HEAD SOC. SCREW, 10-32 X 3/82** Components can not be ordered separately. Sold as an assembly only.* Furnished only on special order4Maintenance and Repair:The GH-703 Power Riveter has been manufactured to give maximum service with minimum care. In order that this may be accomplished, the following recommendations should be followed:1. The hydraulic system should be full of oil and free fromair at all times.2. Keep excessive moisture and dirt out of the air supplyto prevent wear.3. Do not pound on the rear of the tool head to forcerivets into holes, as this will damage the tool.4. Make sure the pulling head is correctly andsecurely attached.To fill riveter with oil:1. Remove head body assembly from handle assembly.2. Fill handle assembly with automatic transmission fluid(ATF-Dexron®) to within 1/8” of the top of the handlecasting.3. Replace head body assembly, being sure gasket (55)and O-ring (56) are properly in place. Tighten cap screws(57) uniformly to prevent leakage around gasket.4. Connect tool to air line and cycle ten times to fullycirculate hydraulic system with oil.5. With tool connected to the air line, remove cap screw(16) being sure NOT to cycle tool. Attach Avdel® airbleeder 700A77 according to instructions included with bleeder and purge system of air by cycling the tool until oil flow is free of air bubbles.6. Remove air bleeder and allow excess oil to drain fromscrew hole.7. Reinstall cap screw (16) and Stat-O-Seal washer (15)and test tool for proper function by installing rivets.NOTE: Steps 1 through 4 may be eliminated when replacing just a small amount of oil.Troubleshooting:1. Check air line for correct pressure at the tool. It mustbe 90 to 120 psi.2. Check tool for lack of hydraulic fluid (see oil fillinginstructions). 3. Check for oil leakage.a. Oil leaking around the cap screw (16) in the headindicates that the screw is loose or the washer gasket(15) needs replacing.b. If oil should leak through the bypass hole at the baseof the handle (34), the O-rings (18 or 37) are wornor damaged.c. Oil leakage from the front of the head (1) indicatesthat O-rings (2) are worn or damaged.4. Check for excessive air leakage from air bleed valve.a. If spring (46) is broken or dislodged, replace perinstructions on page 7.b. If O-rings (51) on plug (52) are worn or damaged,replace.c. If O-rings (47) on valve spool (48) are worn or damaged,replace.5. Check movement of piston (4). If it does not move freely oris slow in operation:a. O-rings (2), (5), or (7) may be damaged and requirereplacement.b. Piston (4) may be mechanically locked due todamaged parts.c. Power piston may be held off its seat on rod (43)allowing oil to bypass. Drain tool, flush thoroughly,and refill with fresh fluid.d. Muffler (53) or air filter inside spool (48) may be pluggedwith dirt. Clean them thoroughly with normal solventand back-blow with compressed air.e. Hole in metering screw in valve spool (48) may beblocked or damaged. Hole diameter should be .028”.Clear and size or replace valve spool.6. If the tool cycles repeatedly, even though the trigger has not been pulled, it indicates that the spring (46) which holds the valve sleeve (45) is broken or dislodged. See air bleed valve instructions on page7.7. If the mandrel sticks in pulling head:a. Pulling head components need maintenance.Disassemble pulling head, clean, and replace wornparts. Reassemble following instructions on page 8.b. There may be excess oil in front of the head piston.With tool attached to air line, remove cap screw (16)and allow excess oil to run out. Replace cap screwand tighten.c. The mandrels are wedged side by side in jaw follower(3)or tube (10) from failure to eject spent mandrel fromtool prior to inserting next rivet. Disassemble pullinghead, clear jaw follower, and reassemble followinginstructions on page 8.8. If the mandrel breaks above designed breaknotch:a. Jaws (2) are not seating on mandrel properly due towear. Replace if worn.b. Jaws (2) are not seating properly due to worn jaw spring.Replace if spring is less than 2” long.5Overhaul:The disassembly and reassembly procedure can be accomplished by utilizing the following instructions and the drawings on pages 4 and 5. Use extreme care during disassembly and reassembly not to mar, nick, of burr any smooth surface that comes in contact with O-rings. Before installing O-rings, be sure to apply a good rubber lubricant, such as Lubriplate, to the surfaces. It is recommended that the special assembly toolsshown here be used to facilitate the overhaul.Virtually all of the moving parts in this tool ride on O-rings, protected by backup rings where high pressure dictates. This means no metal to metal wear. By use of close tolerances and low microinch surfaces against which the O-rings seal, a long life can be expected before any overhaul becomes necessary. At that time, a complete overhaul can be achieved by the use of Service Kit G703KS, which contains a complete set of O-rings, backup rings, screws, washers, and gaskets.Air Bleed Valve:To disassemble, first disconnect the tool from its air source. Remove retaining ring (54) and muffler (53). Insert a 5/16-18 threaded rod or bolt into end of valve plug (52) and pull it out. Using the same procedure, pull out spool (48).NOTE: It should never be necessary to remove valve sleeve (45) unless the ports in the sleeve are plugged up tightly from contaminated air. The O-rings on this sleeve are static and hence do not wear. If it is suspected that the ports are plugged up, use needle nose pliers to grasp end of spring (46), turning clockwise and pulling to dislodge from groove in casting. With spring removed, valve sleeve (45) can be pulledout using an 837B10 valve sleeve removal tool.To reassemble, reverse the above procedure, being certain that all O-rings are properly lubricated before installation. The spring (46) is best installed using an 836B10 spring inserting tool to push the large diameter coil into the casting groove. This requires care, as the tool will not operate if this spring is not anchored firmly.Handle:To inspect the air cylinder bore, remove only parts 27 through 31. Any further disassembly will require removal of the head assembly first.For this complete disassembly, start by removing parts 27 through 31. Next, holding tool upright, remove four socket- head cap screws (57). Lift head assembly from handle (34) and set aside O-ring (56) and gasket (55). Empty all hydraulic fluid into a container by pouring from the handle.Place piston rod wrench 700A61 down into top of handle, onto the hex head of the power piston (63). While holding this wrench, remove the conelok nut (26) using a 7/16” socket wrench. Still holding piston rod wrench, remove the air piston (24) using packing plug wrench 700B65, by turning counterclockwise. When the air piston is completely freed from the piston rod, tap or push on the piston rod wrench to eject piston from the bottom of the handle.After the removal of the air piston, slide piston rod (63) back up to the end of its travel. Using the packing plug wrench remove packing plug (20). It may be necessary to hold the handle upside down in a vise while loosening the packing plug. With packing plug removed, the power cylinder (36) can be tapped out by lowering the power cylinder tool down into the top of the handle onto the top of the cylinder. The O-rings and backup rings (17 & 18) are best removed (and replaced) by using a thin, bent hook. Care must be taken to avoid damaging the O-ring grooves or cylinder.Head:Always remove the complete pulling head from the tool before attempting disassembly of head body.Remove end cap (11). Seal tube (9) comes out with cap asit is held in place by two retaining rings (10). These need not be removed.Push against threaded end of head piston (4) to slide it out of head body (1). Be careful not to damage threads or cause burrs on polished piston rod surface. O-rings (2) and backup ring (3) can now be removed using a bent hook. O- rings (8) can be removed in the same manner.Upon reassembly, be sure to install O-rings and backup rings carefully to avoid cutting them. Also, always lubricateany O- rings with Lubriplate. The reassembly sequence isthe opposite of disassembly. This includes filling the handle(34) with hydraulic fluid before replacing gasket (55) and O-ring (56), just prior to replacing head assembly. (See oil filling instructions.)Tighten the four socket-head cap screws (57) uniformly to prevent leakage around the gasket. When assembled,purge the system of air by using Avdel Cherry air bleeder 700A77 according to instructions included with bleeder. (See oil filling instructions.)6I n s t a l l i n g t h e H703 a n d H743A P u l l i n g H e a d s1. Connect the tool to the air supply. Without depressing thetrigger, place spring (9) over tube (10 or 3) as shown, and insert as far as possible into head piston.2. H743A. Place jaws (2) inside collet (5). Place 2 O-rings (6)over jaw follower (3) and cushion (8) over spring follower (7).Assemble jaw follower (3) and spring follower (7) and insert into collet (5). Screw this assembly onto the head piston, making sure the tapered end of the jaw follower (3) is properly aligned in the bevel in the back end of the jaws (2). 3. Thread nosepiece (1) completely into sleeve (4) and place(4) into end of head body while depressing the trigger. Tightensnugly.5. Tighten jam-nut (11) securely.6. These pulling heads will give long life if properly maintained.This includes keeping the head clean and dry and all the parts securely tightened. The only lubrication required is a little Lubriplate inside the cone of the collet to assure a sliding action against the back of the jaws.7. In case of damage or wear to pulling head parts, dismantleand replace with parts selected from the following list.7REF. NO.QTY,REQDNOSEPIECE PART NUMBERUSING LISTED PULLINGHEADS RIVETDIAM.COMMERCIAL FASTENER TYPENRIVETQRIVETC-MRIVETTRIVETMONOBOLTKTRIVETGRIVET H703H743A11*728A93Z—3/32ALL——————728A9-4—7/8ALL ALL—————*728A9-704—5/32ALL ALL—————728A9-4—3/16——ALL————728A9-6*743A7-5C6Z ALL ALL—————*703A25-6T*703A25-6T———BSPT———*703A25-6TA*703A25-6TA———BAPTS————*743B35A————ALL—ALL—*743053—————ALL (2)—728A9-6*743A7-5C6Z1/4——ALL—————*743A7-8Z(7)(3)——————*743A25-8TA———BAPTS————*743B32A————BAPV—BAPG—*743051—————ALL(2)—REF.NO .QTY.REQD .PART NUMBER FORLISTED PULLING HEADS DESCRIPTIONH703*H743A41703B7743B91SLEEVE111743A18743A18JAM NUT51703A8743B92COLLET21(SET)728B4(2PC)743C55(3PC)JAWS31743A8-8Z743B93JAW FOLLOWER62—P1195O-RING81—743A95CUSHION71—743B94SPRINGFOLLOWER91732A8732A8JAW SPRING101—743A14-8Z EJECTION TUBE(1) AAP AND BSP.(2) REQUIRES TWO PULLING STROKES TO SET RIVET.(3) AAPQ and BSPQ.*MUST BE ORDERED SEPARATELY.8LOCTITE® is a registered trademark of Henkel CorporationDEXRON® is a registered trademark of GM corporation.PARKER® is a trademark of Parker Hannifin CorporationLUBRRIPLATE® is a trademark of Fiske Brothers Refining Co.Santa Ana, Ca 92705Tel: 1-714-545-5511Fax: 1-714-850-6093© 2007 Cherry Aerospace Supplier’s Federal Identification Code: 11815TM-GH-703Rev.: BDate: 06/18/13CR# 13-1230。

Global Industrial Computed Tomography Solutions IndustryExcellence in Best Practices

Company of the Year

Waygate Technologies Recognized as the © Frost & Sullivan 2021 The Growth Pipeline Company™

Best Practices Criteria for World-Class Performance Frost & Sullivan applies a rigorous analytical process to evaluate multiple nominees for each award category before determining the final award recipient. The process involves a detailed evaluation of best practices criteria across two dimensions for each nominated company. Waygate Technologies excels in many of the criteria in the industrial computed tomography (CT) solutions space.

Addressing Key Industry Challenges and Unmet Market Needs through Innovation, Quality, and Differentiating Product Capability

The CT system was introduced for dimensional metrology and inspection applications a decade ago. The CT system’s advantage lies in its ability to combine conventional dimensional metrology with non-destructive inspection of internal parts while providing a three-dimensional (3D) view of the object under inspection.

Inspection On Arrivalnspect unit upon arrival. In case of damage, report immediately to transportation company and your local Modine sales representative.heck rating plate on unit and motor to verify that power supply and motor specification requirements meet available electric power at the point of installation.nspect unit received for conformance with description of product ordered (including specifications where applicable).THIS MANUAL IS THE PROPERTY OF THE OWNER.PLEASE BE SURE TO LEAVE IT WITH THE OWNER WHEN YOU LEAVE THE JOB.Model PTEWARNINGIMPORTANTThe use of this manual is specifically intended for a qualified installation and service agency. A qualified installation and service agency must perform all installation and service of these appliances.FOR YOUR SAFETYThe use and storage of gasoline or otherflammable vapors and liquids in open containers in the vicinity of this appliance is hazardous.Improper installation, adjustment, alteration, service or maintenance can cause property damage, injury or death, and could cause exposure to substances which have been determined by various state agencies to cause cancer, birth defects or other reproductive harm. Read the installation, operating and maintenance instructions thoroughly before installing or servicing this equipment.SPECIAL PRECAUTIONS / IMPORTANT INSTRUCTIONS22-506.152-506.15In locating heaters, consider general space-heating requirements of the area. Unit heaters should be located so that exposed walls are blanketed with warm air. In multiple unit installations, arrange units so that the air discharge pattern of one unit overlaps the next unit thus encompassing the area (See Fig. 3.1 & 3.2). Interference of air streams by columns, beams, partitions or other obstructions should be avoided as much as possible.Locating Unit HeatersFigure 3.1 - Typical Unit Locations for HorizontalAir DeliveryFigure 3.2 - Typical Unit Locations for Vertical DeliveryINSTALLATIONTable 3.1 - Maximum Mounting Heights/Spreads (feet) ➀➀ T he maximum mounting heights consider air delivery to be from the bottom of the unit to the floor based on conditions in Table 6.2. Refer to Figure 3.3.It is recommended that adequate service access in excess of 18 inches be provided for the motor and fan.Vertical Delivery No Deflector Truncone Cone Jet Louvers Model Blades Open Blades Open Blades 45° H S H S H S H S H S VE50 13 20 9 24 18 23 15 13 8 23 VE75 11 17 8 20 15 20 13 11 8 20 VE100 12 18 8 22 17 22 14 12 8 22 VE150 17 26 11 30 23 30 20 17 10 30 VE200 20 30 13 36 27 35 23 20 12 35 VE250 17 26 11 31 23 31 20 18 10 31 VE300 20 31 15 36 28 36 24 21 12 36 VE400 18 27 13 32 24 32 21 18 11 32 VE500 16 24 12 29 22 29 19 16 10 29Height at which unit heaters are installed is critical. Maximum mounting heights for vertical units are listed in T able 3.1. Maximum mounting heights for PTE units are listed inFigure 4.2. The maximum mounting height for any unit is that height above which the unit will not deliver heated air to the floor. The maximum mounting heights must not be exceeded in order to assure maximum comfort.WITH CONE-JETSHFigure 3.3 - Vertical Delivery Heat Spread/ThrowUnit MountingIf necessary, select the correct deflector assembly toaccommodate the area being covered. Note the louver deflector data in the table is listed with louvers fully open and withadjusting vanes set at a 45-degree angle. For these deflectors, vane adjustment provides a greater spread but requires a lower mounting height. As indicated, truncone deflectors allow the lowest mounting height and provide the widest heat spread.Figure 3.4 - Vertical Deflector DimensionsTRUNCONECONE-JETLOUVERSMXLTZIf an optional air deflector has been furnished for vertical units it is always shipped separately and may be attached to the unit before suspension. Louvers on horizontal units may also be added and positioned before installation. Refer to the latest revision of 75-550 for installation instructions for the optional air deflector assemblies.Table 3.2 - Vertical Deflector Dimensions (inches)Model Truncone Cone-Jet Louvers No. M X L T P Z VE50-VE250 12 1/2 22 6 1/2 18 7/8 6 1/2 16 7/8 VE300-VE-500 12 1/2 27 7 1/2 24 3/4 7 1/2 19 3/432-506.15Model PTE Unit SuspensionModel PTE electric heaters are provided with four hanger brackets for installation with four ceiling suspension rods (5/8-inch diameter), furnished by others. Refer to Figures 4.4 and 5.1.NOTE: A pipe hanger adapter kit is available as an accessory from Modine. The kit consists of two drilled 3/4'' I.P .S. pipe caps and two 1/2''-13 x 1 3/4'' capscrews to facilitate threaded-pipe suspension. Two kits are required to pipe-mount a vertical unit. Kit is not available on 480-volt models, VE50 thru VE250 with transformer junction box.INSTALLATIONFigure 4.4 - Ceiling-mounted Model PTEAccessory InstalledANGLE BRACKET FASTENINGFigure 4.2 - Horizontal Delivery with Louver Deflectors (Models PTE300, PTE400, PTE500)MODEL HEIGHT (H) THROW (T)PTE300 17 75PTE400 15 60PTE500 14 45HTBe sure the means of suspension is adequate to support the weight of the unit. For proper operation, the unit must be installed in a level horizontal position. Clearances tocombustibles as specified above must be strictly maintained. Do not install unit heater above the maximum mounting height shown in Table 3.1 for VE models or Figure 3.4 for PTE models or below eight feet.42-506.15For easier installation of PTE model electric unit heaters, where ceiling suspension is not feasible, a wall-mounting bracket kit is available. The bracket saves installation time, has a built-in 5DIMENSIONAL/PERFORMANCE DATA62-506.152-506.15INSTALLATION - ELECTRICAL CONNECTIONSPOWER TERMINAL BLOCKCONTROL TERMINAL BLOCKGROUND LUGCONTACTORTRANSFORMERFUSE BLOCK W/FUSES7INSTALLATIONOVERHEAT CONTROL ELEMENT CONNECTION POWER SUPPLY OPENINGWIRING OPENING 82-506.15OPERATION217896 54 3Operating SequenceThe operation of Modine electric unit heaters is governed byan electrical contactor which is controlled by a thermostat. The contactor completes the electric circuit to the heating elements when the thermostat “calls” for heat. The fan motor is also activated when the thermostat “calls” for heat.When the thermostat is satisfied, the fan motor stops and the contactor opens the circuit to the heating elements.Prior to OperationAlthough this unit has been inspected and tested at the factory, the following procedures should be performed to assure proper on-site operation.Check fan clearance. Fan should not contact casing or fan guard when spun by hand.Check all electrical connections to be sure they are secure, and in accordance with the wiring diagram.Check firmness of unit suspension. Tighten all fasteners, if necessary.Make sure fuses are installed in units that require them.Safety DevicesThe overheat control, (See Figure 9.1), will interrupt power to the unit contactor in the event of overheating. It is a single-pole single-throw switch, with an automatic reset. The switch will permit the motor to continue operation and cool the heater while power to the elements is interrupted. This overheat control should operate only when something is seriously wrong with the unit. When this control operates, correct the difficulty immediately or serious and permanent damage may result.The motor for the circulating air fan has internal thermal overload protection. If for any reason, the motor overheats,the thermal protector will shut it off. The motor will re-start automatically when it has cooled.Initial Start-Up1. Adjust room thermostat above room temperatures.2. Turn on power to the unit.3. Adjust the air deflector (if provided) for desired heatdistribution.4. Run the unit through several cycles by raising and loweringthe thermostat setting to assure proper sequence ofoperation. For Models VE and PTE300, 400, 500 withtwo-stage thermostats, check operation on both states.Three elements should heat up during first stage operation when temperature falls. As additional heat is requiredthe remaining three elements will be energized until thethermostat high-stage setting is satisfied. The unit willautomatically shut off when the low-stage thermostat setting is satisfied.92-506.15GENERAL MAINTENANCE102-506.15TROUBLESHOOTING112-506.15COMMERCIAL WARRANTYSeller warrants its products to be free from defects in material and SHALL, WITHIN THE APPLICABLE WARRANTY PERIOD DEFINED HEREIN© Modine Manufacturing Company 2018。

Various Aseptic UHT SystemsIndirect Plate SterilizerUHT systems based on plate heat exchangers are used where the manufacturer’s primary requirement is a dependable system for heating liquid products at minimum operating costs. In Fig. 11.1 a flow diagram illustrates the principle design including some of the processing parameters.The system can be built up to a maximum capacity of 25-30,000l/hour.Advantages:• Excellent for low viscosity products• High regenerative effect and low energy consumption• High heat transfer area in minimal space• Easy inspection• Low hold-up volume• High degree of flexibility• Variable capacity• Large capacity plants• Relatively low investment• Low CIP costsLimitations:•Limited capability for particulates or fibers• Exchange of gaskets required periodically•Unsuitable for high pressure drops• Some product degradation may occurProducts:• Milk, flavored milk• Fermented milk products, drinking yogurt• Cream, coffee whiteners• Soy milk• Baby food• Juice• Coffee, tea• Combination plants for milk, juice, coffee, tea, etc.Indirect Tubular SterilizerUHT systems based on tubular heat exchangers have become popular in many countries and are typically chosen where large volumes of commodity products have to be processed at the lowest possible costs.In Fig. 12.1 a flow diagram illustrates the principle design including some of the processing parameters.Fig. 12.2 shows how the pressure drop affects the maximumrunning hours.In a plate based sterilizer, the increase in pressure drop is limited to 30-40 percent. This is not a limiting factor in tubular systems, and 16-20 hours operating time between CIP is possible. It isalso possible to operate with an intermediate cleaning each 20hours and reduce the full CIP cycles to once a week, whichmay increase the capacity by as much as 7-9 percent. Exacttimes will depend on particular products and micro-biological considerations.Advantages:• Less vulnerable to fouling, giving long production runs• High operating pressures are acceptable•Processes products with fibers and particulates•Processes high viscosity products• Low shear characteristics for cream• Low requirement for gasket material and easy gasket exchange• Very robust design• Low maintenance costs• Can be designed as a multi-purpose plant• Easy to operateLimitations:• Lower regenerative effect than for plate sterilizers• Slightly higher investment costs compared with plate sterilizers•Higher degree of product degradationProducts:• Milk, flavored milk• Fermented milk products, drinking yogurt• Cream, coffee whiteners• Whipping cream, ice cream mix• Evaporated milk, desserts, puddings• Soy milk• Coffee, tea• Juices, juices with pulp• Salad dressings• Gravy, sauces, soups• Combination plants for milk, juice, coffee, tea, etc.Steam Infusion SterilizerUHT systems based on infusion heating are used where the manufacturer wants to produce a high quality product with as little heat degradation as possible. Also, flexibility in throughput and variety in product range speak for an infusion based system.In Fig. 13.1 a flow diagram illustrates the principle design including some of the processing parameters.The system can be supplied from 40 gal./hr. (pilot plant) to11.624 gal./hr. with a temperature profile as shown in Fig. 13.2. The plate heat exchangers for preheating and cooling can be replaced with tubular heat exchangers as an option. The APV infusion UHT concept can also be supplied as an add-on solution to all common UHT plants from other manufacturers.Fig. 13.2 shows a comparison of various temperature profiles for infusion based processes which are all characterized by a very rapid and controlled heating and cooling profile, and a short and carefully monitored holding time.Advantages:• Gentle and accurate heating in the infusion chamber• Accurate holding time• Superior product quality• Closed loop during pre-sterilizing• High product flexibility• Low fouling rate• Long operating time• Operator friendlyLimitations:• Relatively higher capital costs compared to indirect systems • Relatively higher operating costs due to lower heat regeneration • Requirement for culinary steamProducts:• Milk, flavored milk, creams• Soy milk products• Vla, custard, pudding• Soft ice mix, ice cream mix• Baby food, condensed milk• Processed cheese• SaucesHigh Heat Infusion SterilizerThe growing incidents of heat resistant spores (HRS) arechallenging traditional UHT technologies and setting new targets. The HRS are extremely heat resistant and require a minimum of293-302°F for 3-10 seconds to achieve commercial sterility. Ifthe temperature is increased to this level in a traditional indirect UHT plant it would have an adverse effect on the product qualityand the overall running time of the plant. Furthermore, it would result in higher product losses during startup and shutdown, and more frequent CIP cycles would have to be applied. Using the traditional direct steam infusion system would result in higher energy consumption and increased capital cost. On this basisAPV developed the new High Heat Infusion system.In Fig. 14.1 a flow diagram illustrates the principle design including the most important processing parametersFig. 14.2 shows the temperature/time profile in comparison to conventional infusion and indirect systems.Note that the vacuum chamber has been installed prior to the infusion chamber. This design facilitates improvement in energy recovery and it is possible to achieve 75% regeneration compared to 40 % with conventional infusion systems and 80-85% with indirect tubular systems.Advantages:• Micro-biological product safety by elimination of HRS spores• Very long operating time between CIP• Reduced contamination risk having vacuum chamber on nonaseptic side • No flavor losses• Add-on solutions and combi systemsLimitations:• Capital investment costs• Requirement for culinary steamProducts:• Milk and milk products• Desserts•Other products as with conventional infusion systemsInstant Infusion PasteurizerThe infusion heating principle has increasingly been used for high viscous and sticky products. However, some products have been found to be very difficult or nearly impossible to handle unless very short run-times were accepted.This challenge led APV to develop the patented Instant Infusion system. The objective was to design a system where a high kill rate can be achieved using high pasteurization temperatures and very low holding time (<0.5 second) for products like egg whites and whey protein concentrate.The patented design principle for the Instant Infusion Pasteurizer is based on the conventional infusion system. In order to havean efficient removal of the viscous and sticky product from the infusion chamber, a positive displacement pump has been placedin the outlet tube from the bottom cone very close to the actual cone. This effectively prevents any type of buildup of product at the bottom of the infusion chamber, and it has been possible to increase the number of operating hours between CIP cycles froma few to more than 20 hours for some products.In Fig 15.1 it shows the design of the infusion chamber with the pump arrangement.Advantages:• Can handle high fouling products with long running time (>20 hours) • High degree of flexibility• Reduced chemical changes in comparison to conventional infusion • Very high product qualityProduct:• Whey protein concentrate• Egg-based products• Baby food• Processed cheeseSteam Injection SterilizerThis system operates by direct injection of steam into the productthrough a specially designed nozzle as previously described (Fig. 8.4).The heating is followed by flash cooling and final cooling,which take place in either plate heat exchangers or tubular heat exchangers.The system is in its basic design, quite similar to an infusion system where the infuser has been replaced with an injection nozzle (Fig. 16.1).Long operating times are possible because only a very small area in the nozzle is subject to fouling.The operating economy has been optimized throughoptimization of plant design, processing parameters and careful process control.The injection system handles low to medium viscosity products, inthe capacity range from 528 to 6,604 gal./hr.Advantages:• Good product quality• Long production runs• Handles heat-sensitive productsLimitations:• Higher capital costs than for indirect systems• Higher operating costs due to lower heat regeneration• Mostly used for low viscosity products• Requirement for culinary steamProducts:• Milk, flavored milk, cream• Soy milk• Ice cream mixScraped Surface Heat Exchanger SterilizerScraped surface heat exchangers (SSHE) are the most suitable equipment for treatment of high viscosity food products and food products containing larger particles.In a typical aseptic plant, the product is pumped by a rotary lobe pump (or similar) to feed one or more heating cylinders, followedby a holding tube and one or more cooling cylinders. Capacitiesup to approximately 2,642 gal./hour are available but this depends — to a large extent — on the physical characteristics of individual products.Since the nature of the products can vary considerably in termsof viscosity, stickiness or size and fragility of the particles, each system is individually engineered to suit a particular product.Even though systems based on SSHE are relatively expensive,both in terms of investment and energy consumption, they are still very competitive compared with batch sterilizing systems. Advantages:• Handles high-viscosity products• Handles sticky products• Handles particulates up to approximately 13 mm• Handles heavy-fouling productsLimitations:• Relatively high capital cost• Relatively high energy requirements• Higher maintenance costs due to scraper blades, bearings and seals • High spare parts requirement• Limitation in respect to size of particulatesProducts:• Milk concentrate• Yogurt• Processed cheese• Whey protein concentrate• Quarg products• Baby food• Compotes• Puddings, dips• Sauces, soupsChoosing the Right ProcessIn order to be able to produce a product with specific product qualities in the most cost-effective way, it is essential to make the correct choice with respect to processing system and technology.In many cases the choice is straightforward, but in other casesthere may be more options to choose between. Some of the more important questions to ask when choosing a system are:• What is the specification of the product to be processed?• What are the quality requirements to the final product?• Viscosity specifications of products and raw materials?• Specification of particulate and fiber content/size and shape and variation in content?• Acidity of product/high or low acid?• Sensitivity to high temperatures/heat stability?• Requirement for flexibility/multi-purpose systems?• Requirement for variable capacity?• Requirement for direct or indirect systems?• Skills of technical personnel/operators?Fig. 7 illustrates three of the selection criteria — viscosity, capacity and content of particulates — for the most common processing systems.The systems are often flexibly designed to allow for processing a range of products in the same plant.It is quite common to process both low-acid (pH>4.5) and highacid (pH<4.5) products in the same UHT plant.However, only low-acid products require UHT treatment to make them commercially sterile.Spores cannot develop in high-acid products such as juice,and the heat treatment is therefore only intended to kill yeast and molds.Consequently high-temperature pasteurization at 194-203°F for15-30 seconds is sufficient to make most high-acid products commercially sterile.In some cases where new products have to be processed it maybe necessary to carry out trials on a small scale to observe the performance of specific products in different types of systems. APV has designed a pilot unit for this purpose.The trend for processors to focus increasingly on flexibility to process a range of products and the importance of being able to produce high quality products, have driven the choice of systems towards indirect tubular systems and direct steam infusion systems. The following sections deal with the various heating principles and UHT systems followed by a more detailed comparison of the individual systems.。

ENCORE OPERATIONS MANUALINTRODUCTIONThank you for choosing the Encore grinder. You’re on the road to making great tasting coffee!The Encore offers an easy and simple coffee-grinding experience, resulting in a delicious coffee-drinking experience for you. Below are detailed descriptions of the features that make the Encore stand out from other grinders in its class. Encore™Precision Conical BurrsManufactured in Europe, the Encore’s 40 mm conical burrs will grind for many styles of coffee. Its hardened steel burrs produce the quality grind that is going to make a key difference to the taste in your cup. Our conical burrs grinders are exceptional at producing consistent grinds from very fine to very coarse as well as being durable and will remain sharp for many years.Grind AdjustmentThe Encore has 40 distinct settings to enable grinding from espresso to French Press with the simple turn of the hopper. This range of grind settings helps you explore an extensive range of brew methods (AeroPress, Hario V60, Chemex, automatic drip brewers).Efficient MotorThe Encore houses a powerful DC motor that produces more than four times the output with twice the efficiency of a standard AC motor found in most grinders in this class. The motor spins at less than one-third the speed, making it quieter and lower in pitch. Extremely well-made, the motor is built to handle long-duty cycles. In addition, it possesses a thermal safety device that protects the motor fromoverheating and automatically resets once the motor cools.TABLE OF CONTENTS INTRODUCTION1 TABLE OF CONTENTS2 SAFETY INFORMATION3 PARTS IDENTIFICATION4 OPERATION5 Setting the Grind Control6Manual Switch Operation6Front Mounted Pulse Button6CARE AND CLEANING7 Removing the Bean Hopper7Removing the Ring Burr7Cleaning the Grounds Bin, Hopper and Burrs7Replacing the Ring Burr7Replacing the Bean Hopper8Clearing a Clogged Grinder8Automatic Cleaning8WARRANTY AND SERVICE9SAFETY INFORMATIONPlease read the information below very carefully. It contains important safety information for this appliance. Please keep these instructions for future reference.CAUTION: ALWAYS unplug the electrical supply cord prior to cleaning the grinder.!Use only with AC current and the correct voltage. See the label on the base of the grinder to determine the correct voltage.!Only clean the grinder housing with a dry or slightly damp cloth. Do not immerse the grinder, plug or cord in water or any other liquid.!Baratza will not accept any liability for damage, injury, or warranty if the grinder is used other than for its intended purpose (i.e. grinding roasted whole coffee beans) or is improperly operated or repaired.!Keep the appliance and its cord out of reach of children aged less than 8 years.!Do not operate the grinder with a damaged cord or plug. If the supply cord is damaged, it must be replaced by the manufacturer, its service agent or similarly qualified persons in order to avoid a hazard.!Do not leave your grinder unattended while turned ON.!This appliance can be used by children aged from 8 years and above and persons with reduced physical, sensory or mental capabilities or lack of experience and knowledge if they have been given supervision or instruction concerning use of the appliance in a safe way and understand the hazards involved.!Cleaning and user maintenance shall not be made by children without supervision.!Always unplug the grinder from the electrical supply before assembling, disassembling or cleaning. To unplug, grasp plug and remove from the outlet. Never pull on the cord.P ARTS IDENTIFICATION1. Hopper Lid2. Bean Hopper3. Grind Setting Indicator4. Black Silicone Gasket(cut away in 2nd illustration)5.Removable Ring Burr 6. Grind Adjustment Scale 7. Pulse Button8. Grounds Bin with Max Fill Line 9.On/Off Knob *10. Brush *11. Weighted Base12. Grind Adjustment Ring 13. Grind Adjustment Tab 14. Burr Alignment & Lifting Tabs 15. Wingnut (do not remove)16. Center Cone Burr * included in grounds bin2413OPERATIONIMPORTANT TO KNOW BEFORE USING YOUR GRINDER• F ollow the steps in the Quick Start Guide (included with your grinder or available online here)to get your grinder ready for use• B e sure all parts are washed, dried, and clean. If you need further instructions, check out the Care & Cleaning section Prior to using your Encore grinder for the first time you should wash the bean hopper and grounds bin in warm soapy water. Be sure to fully dry these parts before re-installing. See the section on Care and Cleaning for instructions on how to remove and reinstall these parts. There may be some rust or discoloration on the burrs when you receive your grinder. This is normal and will disappear after a small amount of coffee has been ground. To remove the rust and season the burrs, grind 50 grams of coffee and discard.INITIAL OPERATION• P lace the Encore on level surface, plug into AC Outlet• Remove lid from hopper, pour in roasted beans and replace the lid• Ensure grounds bin is in place• Set the grind adjustment/control* (see below for details)• Use On/Off switch, or front mounted pulse button to start the grinder* Grinder will not activate if above setting 40SETTING THE GRIND CONTROLThe grind setting indicator moves from coarse (40) to fine (1). Slowly rotate the bean hopper clockwise or counter clockwise to align the grind setting indicator on the bean hopper with the desired number setting on the grind scale. Turning the hopper to the right ( → ) produces a coarser particle size and left ( ← ) produces a finer particle size.The settings shown in the table below can be used as a general starting point. The actual grind size for a particular setting will vary depending on many factors including: degree of roast (light vs. dark), freshness, humidity, type of bean, oil content, etc. With use, you will determine the setting that is right for your taste, brewing style, and your favorite beans.EspressoAeroPressHario V60Automatic Brewer ChemexFrench Press Suggested Setting 81215182028MANUAL SWITCH OPERATIONYou may rotate the On/Off switch clockwise or counter clockwise from any position without damaging it.* Leaving the grinder unattended while grinding a large dose may result in a clogFRONT MOUNTED PULSE BUTTONFor short duration grinding, the Encore is equipped with a front-mounted pulse button.Push and hold the pulse button to grind; the grinder will grind as long as the button is pressed. Grinding will stop when the button is released.Note: It is important that if using an espresso basket, hold it below the discharge chute so that coffee powder can fall freely into the basket. Holding the basket too close to the dischargechute may cause coffee to back up and clog your grinder.Note: Partially ground coffee beans may remain between the burrs after the grinder is turnedoff. When making ANY grind adjustments, the grinder must be running.CARE & CLEANING REMOVING THE BEAN HOPPERRemove all beans from the hopper then press the front-mounted pulse button to grind any remaining beans through the grinder. Remove the plug from the power outlet. Remove the hopper by rotating it counterclockwise until it stops and then lift the bean hopper off of the grinder.REMOVING THE RING BURRPull the black silicone gasket off the top of the ring burr. Remove the ring burr by lifting it straight up out of the grinder by the lifting tabs. If the burr does not lift out, ensure that the grind adjustment ring is turned fully counterclockwise. CLEANING THE GROUNDS BIN, HOPPER & BURRSWash the grounds bin, hopper, and the hopper lid in warm soapy water, then rinse and dry. If the grinder is used daily, the burrs should be cleaned at least every few months using tablets (see below for Automatic Cleaning) or with a stiff brush. Proper cleaning enables the burrs to achieve the most consistent grind possible. Cleaning also removes some coffee oils, which will stale and degrade the flavor of the ground coffee.REPLACING THE RING BURREnsure that the black adjustment ring is rotated counterclockwise as far as it will go. Replace the burr by lining up the red tab on the burr with the rectangular cutout on the black adjustment ring. Both should be lined up with the setting 30. Wiggle and push down firmly on the ring burr to ensure that it seats properly. After replacing the burr, place the silicone gasket on top of the ring burr by aligning the two notches in the silicone gasket with the ring burr tabs (one of which is red) and gently work the gasket down until it is seated on the top 1⁄8” (4mm) of the ring burr.Caution: Do not put the bean hopper, hopper lid or grounds bin in the dishwasher. Hand wash only. Do not immerse the grinder housing in water. Do NOT wash the burrs with water, or they will rust.REPLACING THE BEAN HOPPERTo replace the bean hopper, line up the silver grind setting indicator tab with the black triangle on the right side of the grind setting scale, near setting 40. Once the hopper is in place, press down gently, and rotate it clockwise to lock it in.CLEARING A CLOGGED GRINDERIf your grinder is not dispensing coffee normally, it could be clogged with coffee powder. This can happen if the groundsbin or portafilter are overfilled and ground coffee gets backed up into the grounds chute and grinding chamber. It can also happen with the buildup of coffee powder over time. Clearing a clog requires more effort than and is different from a normal cleaning, as coffee becomes packed in a hard-to-access passageway between the burr and grounds bin. The clog needs to be cleared with the aid of tools.Go to the Troubleshooting section on /troubleshooting for help unclogging your grinder.AUTOMATIC CLEANINGA thorough, fast, and easy cleaning can be accomplished using biodegradable grinder cleaning tablets. Grinder cleaning tablets are designed to dislodge coffee particles, absorb/remove odors, as well as coffee oil residue. Remove all beans from the hopper and run the grinder to remove any beans inside. Place the recommended amount of tablets into the empty grinder hopper. Adjust the grind setting to 30, insert the grounds bin and use the dial to run the grinder. Grind all of the tablets into the bin. Once complete, we recommend grinding approximately 30g coffee to remove any tablet residue. Discard the ground tablets/coffee.* Rice is not a substitute for grinder cleaning tablets. It may damage components within the grinder.WARRANTY & SERVICE U.S. & CANADIAN WARRANTY INFORMATIONLimited Warranty for Baratza Grinders is 1 year from the original date of purchase or 25 hours of cumulative run time, whichever occurs first. This warranty covers all defects in materials and workmanship (parts and labor) including free ground transportation to and from our repair facility within the US and Canada. This warranty does not apply to: improper use, lack of cleaning, abuse, normal wear and tear, lack of proper adjustment, foreign objects (stones, screws, etc.) in the beans, or uses outside the intended use of grinding whole roasted coffee beans (roasted beyond 1st crack). If your grinder fails within one year,*******************************************************************.For additional warranty, support, or troubleshooting information, go to .INTERNATIONAL WARRANTY INFORMATIONFor all countries outside the US and Canada, the warranty, support and service is provided by the International Retailer you purchased from. If you purchased this grinder from a retailer outside of the country you live in, you may be responsible for any shipping costs to service the grinder, and you may need to pay for service.PROOF OF PURCHASE & PRODUCT REGISTRATIONYou can register your grinder at /register-your-grinder. Registration will enable us to contact you in the unlikely event of a product safety notification and assist us in complying with the provisions of the Consumer Product Safety Act. The serial number is located on the bottom of the grinder. Please keep your sales receipt that shows the date of purchase. FOR REPAIRS OR QUESTIONSEmail: *******************For Parts and Information go to: For Troubleshooting Help: /troubleshooting©2019 Baratza124th Avenue NESuite A108/109Bellevue, WA 98005, USAManual Revision Date 09/11/2019。

GEMeasurement & ControlISOVOLT Lynx 160 / 320New Generation Stationary X-ray GeneratorThe ISOVOLT Lynx is the first in a new generation ofstationary X-ray machines from Inspection Technologies.It represents a major advance in X-ray generator technology,incorporating the latest electronics and digital conceptsto allow greater performance and reliability. It has beendesigned to align with the optimized performance of othercomponents in the X-ray inspection imaging chain for a widerange of applications including the automotive, aerospaceand metals manufacturing sectors, for tasks such as theinspection of welds, composites and castings, as well as in 3Dcomputed tomography and metrology. It will be of particularinterest to system integrators working in both the industrialand scientific sectors.ISOVOLT Lynx GeneratorThe journey has just begun ...GE introduces the next generation of stationary X-ray machines with the new ISOVOLT Lynx, which is one of the most significant innovations in X-ray generation for the past 10 years.There have been enormous strides in imaging and tube technology over the past decade but the generator technology has been pretty static. By leveraging many of the concepts employed in the GE healthcare business, using their latest state-of-the-art technology, we have been able to develop this new industrialized version for industrial customers. This development has required us to create an application map for each potential generator application and then define the generator specifications needed to meet and optimize the tube, imaging and inspection standard requirements for that application.1. ISOVOLT Lynx GeneratorThe result is a flexible and versatile generator platform which offers high reliability and performance across a very broad application spectrum. It is also a very scalable platform, which will allow us to meet future integration and monitoring requirements and the needs for higher energies, even up to 600 kV. In a first stage the ISOVOLT Lynx will be available as 160 kV and 320 kV version.Both generators offer enhanced maintenance freeoptions: maintenance free high voltage plugs on thegenerator side and new maintenance free bipolar tubehousing for the 320 kV version. The integration into fullyautomated systems for in-line operation has also beenoptimized. The optional ISOVOLT Lynx Remote Controlor the ISOVOLT Lynx Control ensure a simpleconfiguration, control and operation.Features & BenefitsR e l i ab i l it ySafety&Performan ceF l e x i b i l i t yS e rv i ceability&CostofE a se o fComplianceD i agnosticsOwnershipI n te g ra t i o nReliability Safety & Compliance PerformanceFeature Benefits State-of-the artscalable, high-frequencyMOS-FET driven, power electronics designed Feature BenefitsIntegrates all safetyrelevant mechanismsFeature BenefitsNominal power45 mA*, 4500 W*Safety&Performan ceF l e x i b i l i t yS e rv i ceability&CostofComplianceD i agnosticsOwnershipI n teR el i a bi l i t yf e t y&r v i c ea b i l i t y&C os tofEaseofC o m p l ia n cD i a gn o s t i c sOw ne r shipIntegrationP e r f o r m a n ceFlexibilityServiceability&C o s to fDiagnosticsOw n er s h i pCost of Ownership Ease of IntegrationAssisted X-ray tubecharacteristicsrecognition and digitalparameter adjust-Quick installation procedureFlexibilityFeature BenefitsMaintenance freeoptionNo need for periodic highvoltage plug maintenanceSealed high voltage No spillage, transport andDiagnosticsFeature BenefitsImproved CPUplatform, Onlinemonitoring and datarecording of relevantsystem parameterBetter fault interpretationData collectionOutlook for future:statistical data analysis andpredictive monitoringServiceabilityFeature BenefitsField Replaceable Units(FRU) ConceptQuick replacement of mainmodules, short downtimes(for simplified spare partsmanagement, fast turn-around-time)Simplified trouble-Quick determination of sys-&P er f o r m a n c eF l e x i b i l i tySc e2. ISOVOLT Lynx ControlA user-friendly, multi-language control features a clear full-colour graphicaldisplay with touch screen, that allows simultaneous readings of set and actual operating parameters. Embedded in an ergonomic and rugged desktop or optional 19” rack mounting housing, full control of X-ray operation features, service and system configuration features, online monitoring of relevant system parameters is established. Intuitive guidance through diverse menus as well as unmistakable messages for clear interventions are provided with this module.Features such as free configurable exposure programs, or special programs for constant power, constant current and manual operation cater for individual demands for radiographic or radioscopic inspections. The multi-lingual user display with 16 different languages and extended character sets for Japanese, Cyrillic and Chinese enables comprehensible and simple interaction.ISOVOLT Lynx provides automatic and manual warm-up modes for optimized tube conditioning. A special extended warm-up mode safeguards tube performance under severe conditions and setups.3. ISOVOLT Lynx Remote ControlDesigned for the needs of system integrators this PC based tool provides full control over all ISOVOLT Lynx operation, service and diagnostics features.It can be installed on every WIN 7 or WIN XP PC and can beconnected via a USB/RS-232 cable with the ISOVOLT Lynx generator.Alongside with the optional fail-safe E-Stop Control Box, ISOVOLT Lynx Remote Control establishes a full PC based generator control and management platform.WL 5000 RE OW 4002OL 4503OLK 50Voltage dividerMaintenance free tube housing Junction kits and safety devicesDiaphragms Column standX-ray TubesISOVOLT Lynx supports a comprehensiveportfolio of monopolar and bipolar X-ray tubes from different suppliers.Please contact your sales representative for consultation on X-ray tube selection.AccessoriesSafety devices• Primary interlock switch • Alarm box • Switch box• Flash- and warning lamps • Country specific safety kitsHV cables• In different standard lengths, with quick-lock or flange connections with rubbercone plugs or maintenance free plugs.Dosimetry and calibration kits • Voltage divider Pumps and coolersSee pictures on this pageTechnical Specifications* 40 mA permanent operation, limited to peak operation** Limited to tube specification, temperature and operating mode *** At constant temperature level© 2012 General Electric Company. All Rights Reserved. Specifications are subject to change without notice. GE is a registered trademark of General Electric Company. Other company or product names mentioned in this document may be trademarks or registered trademarks of their respective companies, which are not affiliated with GE.GEIT-30222EN (12/12)Regional OfficesEuropeAmericasAsiaGermanyRobert Bosch Strasse 3 50354 Huerth +49 2233 6010 Lotzenäcker Strasse 4 72379 Hechingen (RVI only)+49 (0) 7471 9882 0Niels-Bohr-Strasse 7 31515 Wunstorf P.O. Box 6241 (RT only)31510 Wunstorf +49 5031 172 0Bogenstrasse 41 22926 Ahrensburg (RT only)+49 4102 807 117United Kingdom892 Charter Avenue Canley Coventry CV4 8AF +44 845 130 3925France68, Chemin des Ormeaux Limonest 69760+33 47 217 9216SpainSan Maximo, 31, Planta 4A, Nave 6 Madrid 28041+34 915 500 59 90United States50 Industrial Park Road Lewistown, PA 17044+1 866 243 2638 (toll free) +1 717 242 0327721 Visions DriveSkaneateles, NY 13152 (RVI only)+1 888 332 3848 (toll free) +1 315 554 2000 ext. 1BrazilAv. Maria Coelho Aguiar, 215 Building C, 6th floorJd. Sao Luiz - Sao Paulo - SP CEP 05804-900 – Brazil +55 11 3614-1840China5F, Building 1, No.1 Huatuo Road, Zhangjiang High-Tech Park, Shanghai 201203+86 800 915 9966 (toll-free) +86 (0) 21-3877 7888Unit 1602, 16/F Sing Pao Building 101 King’s Road North Point Hong Kong+852 2877 0801JapanHarumi Island Triton Square Office Tower X 1-8-10, Harumi, Chuo-ku, Tokyo 104-6023Tel: +81 3 6890 4567Fax: +81 3 6864 1738GE Sensing & Inspection Technologies has sales and service offices all over the world. Below are some of our locations. Visit for a complete listing. • Berchem, Belgium • Alzenau, Germany• Burford, United Kingdom • Moscow, Russia • Bucharest, Romania • Prague, Czech Republic • Stockholm, Sweden •Milan, Italy• East Perth, Australia • Singapore • Dubai, UAE• Buenos Aires, Argentina • Mexico City, Mexico • Airdrie, Alberta, Canada • Toronto, Ontario, Canada •Montreal, Quebec, Canada。

E-mail:feiluo1987@hli@Fei Luo 1, Geng Chu 1, Bonan Liu 1, Jieyun Zheng 1，Mingxiang Lin 1,JunJie Li 1, Qi Fang 2，Suning Feng 2, Wei Chen 2, Hong Li*1,Liquan Chen*1, XueJie Huang 1The second International Forum on Positive & Negative Materials for Advanced Batteries April 23, 2015 , Hangzhou1. Institute of Physics, CAS Beijing 100190 China2. Jiang Xi Zi Chen Technology CO., LTDResearch on composite core/shell (Riceglue-ball) structured nano-Si/C anode fornext generation Li-ion batteriesTriple distanceLighter batteriestransparent small flexiblePerformances of batteriesEnergy densityPower densityCycle lifeService lifeEnergy effi.Self-dischargeSafetyDurabilityCostEnvironmental J. Y . Peng, C. X. Zu, H. Li, Energy Storage Sci. Tech ., 2013, 2, 55-62Advanced batteries are required for many applicationsPurposed roadmap of Li batteries in view of energy densities C. X. Zu, H. Li, Energy Environ. Sci , 2011, 4, 2614J. Y . Peng, C. X. Zu, H. Li, Energy Storage Sci. Tech., 2013, 2, 55-62Graphite:1983——1993——…Silicon based anode:1997 ——2015(?) ——…Li Mental:1962 ——2018(???)——…Background of silicon anodeAdvantages of silicon anode ：(1)High capacity >372mAh/g(2)Low potential vs Li+/Li ：0.4V(3)Low cost(4)Green The next generation lithium ion battery anode material ！For practical application:“(1)+(2)” can contribute to high energy lithium ion batteries .Main issues of silicon anodeHuge volume variation: 290%Unstable SEImain obstacles for applicationM-crystalline Wafer A-silicon film Silicon conesNano silicon Micro-siliconBlack silicon 1st extraction 10th extaction Cu coatingAl2O3 coating Silicon itself modification (size,morphology,coating…) Bidners Conductive additives Electrolyte additives Current collector SEI 10th extaction CS binder 10th extaction10th extractionAfter first chargeAfter first cycle Dense a-Si film Patterned a-Si filmIsolated Si column shows less crackingY . He, H. Li, X. J. Huang* et al, Adv. Mater. 2011, 23, 4938–4941For less crack ，isolated dispersion of Si particle should be taken into considerationSiOx ：Si clusters （2-5nm ）discontinuously disperse in SiO 2 Si/C: Si particles （<100nm ）discontinuously disperse in CSi Si SiSubstrateSubstrate SubstrateA B G. W. Zhou, H. Li, et al, APL, 1999 H. Li et al, SSI, 2000Li insertion SINPs SiNWHow does SEI on nano-Si anode look like? ??SEI :solid electrolyte interface Li insertionC. K. Chan, Yi Cui* et al.J. Power Sources 189 (2009) 1132–1140Identity SEI on nano-Si anode: XPSJ. Swiatowska* et al. JPCC 118 (2014) 2919–2928Rate effect on SEI on SiNWs anodeTOF-SIMS, XPSSEI is thicker at low rateHard to investigate the growth of SEI？A new method to get 3D imaging of SEI: cross section viewCross-section view of 3-D plot Naked surface Thick SEIThin SEIScan Force Curve MethodSEI coverage of silicon thin filmStandard electrolyte is not suitable for silicon（50%）Additive is very important for forming dense SEI with high coverageLarge area silicon nanocone electrodes2015/4/27Mapping and EDX of original SampleH:2.02umHalf-D:170nmH ：2.02µm ElementWeight %Atomic %O K2.62 4.52Si K97.3895.48Totals 100.00SiO Si OThe fabrication of SNCsElectrochemical performance of silicon cone electrodesSEI formation process on SNCs Anode After 1cycle After 2cycleAfter 10 cycles After 15 cyclesAfter 20 cycles After 25 cyclesPrimary sampleAfter 2cycle After 10cycle After 15cycle After 20 cycle After 25 cycleLi x Si nanoconeAfter 25 cyclesHigh rate?The influence of high rate on SEI and cycle performance0.5C after 25 cycles0.5C after 25 cycles1C after 25 cycles1C after 25 cyclesSEI quantity:0.1C >> 0.5C > 1CCyclic performance1C>0.5C>>0.1CEfficiency1C(98.9%)>0.5C(97.6%)>>0.1C(95%)Low rate，thick SEI，consumeLithium irreversiblyAvoiding direct exposure of silicon toelectrolyteCoating and additive are suggestedEvidence for SEI——all solid state battery2015/4/27After 25 cycle After 25 cycleEvidence for SEI——all solid state batteryShort circuit for dis/charge Short circuit for chargeAfter 10 cyclePrimary sampleA new way to design composite solid electrolytesAfter coating，SEI?ElementWeight%Atomic%C K 17.8729.46O K 23.1928.69F K 1.42 1.48Si K 57.3940.30P K 0.120.08Totals100.00Element Weight%Atomic%C K 4.9610.71O K 2.87 4.65Si K 92.1684.64Totals 100.00Primary Sample0.1C 25cycleSEI on Si cones anode after coating polymer layer2015/4/27Primary Sample0.1C 25cycle0-25 cyclePrimary Sample0.1C 25cycleCoating is effective:Much less SEI than non-coating(5µmSEI) Organic SEI >inorganic SEIHigher efficiency (97.6%)than non-coating (95%)From GengChu’s workCarbon Coating and Etching of SNCsNon-Carbon areaCarbon areaNon-Carbon areaElectrochemical performanceAfter carbon coating, polarization is much lower even in high rateThe influence of high rate on cycle performance 1C5C1C 500cycles5C 5000cyclesAfter carbon coating, cycle performance is improved(300 to 500)High rate means high performance, but its hard for applicationWork about SEI after carbon coating is underway…Understanding on SEI and cracking on Si anodeSEI can grow vey thick at low rateSEI is inhomogeneous on SiSEI can used as solid electrolyte Additives are effective toimprove the SEI coverageCoating is effectivePossible effects of SEI:Poor efficiencyCapacity fading in full cellIncrease of internal resistanceVolume expansion Dense Si shows seriouscrackingIsolated Si column structure shows less crackingPossible effects of cracking: Peeling off of active materials graduallyIncreasing internal resistance Destroy SEI filmSEI CrackingSolutions?SiOx/C Proposed solutions on Si anodes （1997-）1)Si nanoparticles, Si nanowires (1997/1999, IoP-CAS )2)Si films (2000, Fukuda; Sanyo)3)Amorphous Si-M-N (2000, J. R. Dahn, 3M)4)C/Si particles (2000, Fukuda; 2001, Samsung)5)Si powder + binder (2001, Sanyo)6)C@Si bilayer thin film (2002, Sanyo, Fukuda)7)C@SiOx (2002, Annakashi)8)C@Si-M-C (2004, IoP-CAS)9)CNT/Si, SiNWs/C (2005, IoP-CAS)10)Mesoporous Si (2005, J. Cho)11)Cu@Si (2008, MITSUI Kinzoku)12)SiNWS array/SS (2008, Y . Cui, Amprius)13)Si/CuNWs array(2011, Altairnano/ORNL)14)Self-healing polymer (2013, ZN Bao and Yi Cui ）15)….Our SolutionC@nano-Si composites Rational design?Volume variation of different anode materials268 867 2700 300 250 200 150LiVolume Variation(%)Li Li4Ti5O12 Si Sn CLi22Sn5Li15Si4100 50 0Li7Ti5O12 LiC670%01000200030004000Specific Capacity(mAh/g)Energy density have considered the volume variation Device permit: 10-20% volume expansion，material permit：<70% Sn:268mAh/g,Si:867mAh/g,Li:2700mAh/gThickness vs Gravimetric Capacity at 3mAh/cm260 268 867 2700Li C Si Sn Li4Ti5O12Thickness（µm）5040 304020Li22Sn5 Li15Si4Li26.2 25.3 20.810 0500 1000 1500 2000 2500 3000 3500 4000Gravimetric Capacity(mAh/g)Each curve means 3mAh/cm2 Li4Ti5O12:49.4µm,LiC6:40µm，Li22Sn5:14.9µm，Li15Si4:14µm，Li:14.7µm Volume variation limit: LiC6:40µm, Li22Sn5:26.2µm, Li15Si4:25.3µm, Li:20.8µmMaterial design of Si anode in term of volumetric energy densityEnergy Density(wh/L)1300 1200 1100 1000 900 800 700 600pressing density for silicon anode80 60 40 201.5g/cm 3 1.3g/cm3Rational designGraphite0500 -20 400 500 600 700 800 900 1000Specific Capacity(mAh/g)Improved Ratio vs Gra.(%)Electrode Volume Variation(%)32 41 62 90Si anode preparation——pilot-scale product line100Kg-pilot plant： Mixing machine，crushing machine，sintering，air classification etc. cooperative company： Jiangxi ZiChen；PTLSi/C composites of 450mAh/g-50Kg2015/4/2735Summary on nano-Si/C anodeAdvantagesHigh columbic efficiency Good cycle High compacted density Robust(rolling,no crack) Free of prelithiation Low cost Easy scalingDisadvantagesModerate rate(0.2C) < 1000 mAh/g >99.9%(hard for full cell)Theoretical energy density of Si-based Li-ionEpractical / Etheory = 30-60 % Li-ion battery over 300 Wh/kg using Si anode is possible Scaling up of nano-Si/C is approaching nowThank you for your attention!。