大学生体验英语视听说B3答案文本
- 格式:doc
- 大小:69.50 KB
- 文档页数:8
Unit 1PART 1Listening 11. FFTTFT2.outside worldat homewave hellobowlook straight into the eyesopenlylook at my feetshy and silentListening II1.1.sensitive independent2.good friend3.life people4.learning being aware2.BCADBListening III1.1.ice-skating2.chemistry3.outgoing, bright, funny4.self-centered5.blond medium height6.runner-up2. TFTFFLstening IV1.1. Four2.Colleagues3.Teacher./Teaching4.Susan5. To go on holiday2.1.Paul:DEJ2. Susan: B F3. Maria: C H4. Peter: AGIPART 21.1.Mike C2Sam E3.Ted D4.Simon A5.Lilly B2.avoid confrontationgenerally likeablehide those traitsaffectionate kind nature stubbornnessworst reputationrevengeful and destructive entertainingtough and determinedintuition and protective nature perfectionistsdraw attentionPART 31.1. The lunar calendar2.Two trines3.Four trines2. who is very good with money who is easily angereddisplay the utmost amount of energy longest life and good fortunewith quick witgreat common senseinspires leadership in others seductive and charmingdeep-thinking and very talented interesting and bravePART 4Listening 1upsetsensiblelecturecalmstrengthlandedswearingperfectlywildlybeeListening II1.BDAACCDCListening III1.1 PELedro C2 Mr. Miller C3. Mr. Smith E4 Jake A5 Mrs. Duke F2.1.favorite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoop Listening IV1.FTFFT2.understand the Scots' English the friendliest peoplemuch nicer thanEngish courtesyno views on the matterUnit 2Listening I1. BABD D(最后一个答案存在疑问,应选C,请读者参考听力录音确认)2. FTTFTListening II1. AABCD2. TFTTFFListening III1.1) stayed around2)mouse catcher3)rats and mice4)got a paw5)weak and thin6)make a wooden paw7)fastened it8)grow sleek and fat9)managed10) peered out cautiously11)seized it with12) 18 miceListening IV1. BDAAC2. FTTTFTFFPART 21.1 C2 E3 D4 B5 A2. in your handused to belong topracticing withtalked to each otherwhy notask forfind a waymanage tohis own loveso foolishly jealousall three of thempeacePART 31. DCABA2.InvadesheltersupplypeacewithdrawflaghangedremembersecretsharequeenPART 4Listening 11. BCBADA2. FFTTFListening II1. 1. CDJ2.AEGH3.BFI2. ABDCBDListening IIITFFFTFTTListening IVassociatedrailroadmerchantdictionariesgrasslandsbringactionOne hundred days after his offer was made, the first herds arrived from the South.Soon there were at least 5000 cowboys bringing cattle up to Kansas from Texas.These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3Part 1Listening 11. BCDA2. FTFTFTListening II1. BDAD2. 30smale190long wavyheavily builtlight red sweaterbeardListening III1. BCAC2.lovetogethermotherhouseschoolfriendsfathermonthbeachcallListening IV1. Stories music next door in love with secretary fights3×4 √2. Celia: 1 √2 √3×4√Sara 1×2 √ 2×3×4√Jack 1 √ 4×Tom 1√2 √ 3√PART 211D 2C 3 B 4 E 5 A3. TFFTTTTTFFPART 31.a central bodytransport visionaccessa race trackslightly slowerhuge success2. car movementcyclingwalkingstrategiesquality of lifevisit the cityinvestmentdesignenvironmentsubtle designfocusPART 4Listening 11.FTFT2.South Americapet foodenough proteindevelopmuch moreAfricapositionnatural resourcesgone downsteadycontinued to risegetting richer and richerListening II1.the first few secondsso thinbeings from another planetfocused onlooked directly atAll arounduntil nowdespair grief and disguststarted cryingwho was sleeping peacefully6×7×8√2. 1√2 √3×4 √5√Listening IIIComplainedworkchestshockedcold-bloodedinvestigationdealingHe had mentioned his concern twice to the local officialWhenever this topic arose he always expressed strong views about drugs.ted to the murder.But it’s still early to say this is relaListening IVpovertycrimedriftbetter workresentmentattractiveeducation servicesa more positive attitudeUnit 4Part 1Listening I×,8√1 1×,2√,3×,4√,5√,6√,721)weaknesses,2) similar abilities and interest, interest you, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combinationListening II1.DDAB2.1)import from abroad 2)sales manager 3)salary 4)sales commission5) travel in 6)experience 7)university 8)on a teamListening III11)Choose their careers, 2) avoid certain careers3) different professions, 4) impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance 2 TFTFTListening IV1.C A C B D2.1)occupation cool2)catch provide fulfilling3)media coming after you make your own work schedule4)have my pick of jobsPart 2×K√L√1. A√B√C×D√E×F√G×H√I√J2 1) computer engineering, 2) computer programmer, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical research, 9) management, 10) 3600Part 31.A√B×C√D√E×F√G×H√2.1)tremendous element of care, what kinds of contributions2)where you’re from3)professional learning, colleagues, peers4)what makes their students tick5)relaxed, care about them, passionate, developPart 4Listening I1)100 million2)35, 403)seven, eight4)office workers, many professionals5)8:00, 4:006)eight-hour shifts7)Monday, Thursday, Saturdays, Sundays8) choose their own working hours, freedom of choice, happy withListening II1.ADCADListening IIICBDCAListening IV1. CABDB2.1) ADF2)BF3)ACEUnit 5:Part 1:Listening 1:1.1.plays, real people real life, emotional, problem, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kind2. F F T T T TListening II:1. 1 C 2 A 3 D2.1.be understood easily2.necessary desirable3.splendid4.prevents, from achieving5.anxiety, effectListening III:1.1.T2. F3. F4. F5.T6.T21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IV:11. C2. C3. A4. B21.eggs, toast2.realistic, far better than, forgetting3.determined, personality culture4.recite aloudPart 2:1.1-B 2-A 3-C 4-E 5-D 6-F2.1.over long distances2.look into it3.five times4.individual group5.sex-specific males females strangers6.great apes7.teach own kind8.raised held look bigger9.round tail-wagging10.feeding every directionPart 31.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.Johned joined6.Siji…Siji Delaney Sinjin Delaney7.Awful lawful8.Spigot spiritPart 4Listening 11.Economic2.religions3.exist4.biologically5.40,0006.cave7.Written8.humans were probably speaking thousands of years before that9.Even while we are reading or just thinking, we are in a sense“talking”nguage is so much a part of human existence that we will betalking as long as we inhabit the Earth.Listening II1. D A B B A2.1.Permission apply for2.application form website3.regular mail faxcredit cards4.traveler’s checksListening III1A×B√ C √D×E√21)Other native languages2)two3)more4)of their choice5)Spanish6)Indians7)English German FrenchListening IV1.1.learner teacher curriculum2.Curiosity expectations goals2.T F T F TUnit 6PART 1Listening I1. BCDB2. TFFFTFLstening II1.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACALisening III1.CABD2.1.crowding war water grass2.what is happening keep the number of horses low3.target practice where the horses were found4.gotten rid of stayListening IV1. FTFTFTFF2. 1×2×3×4√ 5× 6 √PART 21.DABCCA2.1.farm animals hold feed2.small pets toys3.bury toss them out4. real shame5.dangerous destructive bring diseases6.have a point7.humanely limit8.time money warm place9.isolated company10.storm of debatePART 31.ADDBACAB2.1. female collectively2. not a moment3.infinite care4.picks up keft to right5.stuck smarter6.salt water lake dock7.self-aware non-human intelligence belong in captivityPART 4Listening 11.1√ 2×3×4√ 5√ 6√ 7 √ 82.ACCADLstening II1. CBDDA2. 1×2√ 3×4×5√ 6×7√ 8×Lstening III1CADBB2.1.family holiday2.7-foot 18 stones3.stroking adjusting his clothing4.fractured skull black eye broken arm5.lose his love6.cat7.get-well cards presentsLisrening IV1.1)a.whales and dolphinsb.birdsc. tigers2)a. meat oilb.handbags shoesc.furd.ivory2.TFTT。
大学体验英语听说教程3原文与答案大学体验英语听说教程3 原文与答案大验英验验验程学体听教3 Listening Task 部分+答案UNIT1,1.A: Jake SuttonIs that you, man? How are you?B: Hey, Andrew! I didn ' t recognize you for a moment, long time no see!A: Yeah, wow, I haven 't seen you since high school graduation! what' ve you been u p to?B: I ' ve been back East, at collage.A: collage? Where?B: Boston. b. u.A: Oh, cool.B: And this past year, I got to go to Spain as an exchange student.A: Spain? No kidding? I remember you always hoped for an international lifestyle.B: exactly.A: So how was is, amigo?B: Oh, man, it was so great; I got to see a lot of Europe.A: Year! Like where,B: All over. Italy, France, Greece, and my homestay family was really nice. They ' ve invited me back again if I want to go to graduate school there.A; sound s like we won 't be seeing you for anther few more years then, eh?B: I dunno. Half of me wants to go , half of me wants to stayhere , you know, when i was there , I missed home a lot more than I thought I would.A: I can imagine.2.A: so, terry, how have you been?B: good, good.A: How are things going? Did you graduate this year?B: Me? Nah! I went to State, but after my second year, I realize that what I really want to do is take over for my mom in the restaurant.A: Oh, that 's right. Your family owns a little restaurant. Well, I mean, it ' s not so little, but ?…B: So I came back home and started apprenticing as chef.A: Really? That is so cool! You know, now that I think about it, it makes perfect sense for you. Even back in high school, you could cook up a storm. So, how is it being in the restaurant business?B: Well, I love to cook, but, man, I have a lot to learn about running a business. I ' m really glad my mom ' s around to teach me. \A: Well, I ' ll have to come by to try your cooking. What nights do you work?B: Take your pick. I ' m there seven nights a week.3;A: Ken? Ken Mackney, is that you?B: Uh, yeah, I ' m Ken Mackney.A: It ' s me. Barry Simmons. You know, Mr. Jones ' s calculus class, senior year?B: Um, so, how ' s it going? What are you up to these days?A: I ' m pretty busy. I ' m working as an accountant in the city.B: Oh, that 's great! It sounds like you really put your math skills to good use.A: Yeah. And I got married last fall. Hey, you might actually know my wife, Tina Chan, Jason Chan 's little sister?1 / 30Listening Task 部分+答案大验英验验验程学体听教3B: Tina. Is she the one who went to Harvard Medical School?A: No, that was Lisa Fong. Tina went to art school.B: Oh! Well, I guess you and Tina are a good match, then, youwere always into art, too, weren ' t you?A: No, not really, that 's my brother tom you are thinking of, youdon't remember very much from high school, do you?B: No, I guess not! It ' s been a long time!4:A: hi, Kate, it ' s me, Cindy Lohan, you remember me , don 't you?B: Cindy, Cindy. I can ' t seem to place the name. Oh, my gosh, yes!I do remember you! But …A: But what?B: Well, it 's just that you don 't look like the free -spiritedCindy I remember. You look so, so normal.A: Normal? I guess you 're referring to my hair?B: Yeah. I mean, you 're just a regular brunette now. When I knewyou, you always had your hair dyed some interesting color. Blue one day, pink the next.A: Well, I 'm a lawyer now. Most judges have a thing against pink hair, so … B: Ican see your sense of humor hasn 't changed much!Unit 21.Oh, my gosh. You won ' t believe this.What? What happened, Katie (Kate)?You know that guy Brett, from the football team?Oh, yeah, the big dumb jock. What did he do this time?He gave me a poem.A poem?I mean, it ' s beautiful! It ' s romantic and it ' s fu ll of imagery. Ijust couldn 't believe it came from him.You got that right. I didn 't even think he could read.I just found out he plays two musical instruments and speaks French fluently! Hmm, well, maybe there ' s more to Brett than meets the eye.2:Hey, Jeff(Jeffrey), I didn 't know you took dance lessons.What? How did you know that?Your girlfriend showed me some pictures of your dancing.Man, I told her not to show those to people.Aw (used to express sympathy, disgust, or disbelief), come on (hurry, disagreement). Actually, I think it ' s pretty cool. I wish there were something I felt that passionate about. Really, you know I love to dance, but I don ' t tell my friends about it.Dancing is a private thing for me. It 's just something I do for myself.,3 Hey, Kayla. Can I borrow your notes from today 's math class?Yeah, sure, just make sure to give them back to me before my band plays tonight.I need t time to study.Did you say your band?2 / 30Listening Task 部分+答案大验英验验验程学体听教3Yeah. I 'm in a band called R ock Hard. I play the drums (instrument played by beating鼓with the hands or sticks).You're kidding. You play the drums for a rock band? I never would've guessed.Why? Cause I 'm a straight A student?Yeah, I mean you 're the one everyone comes to for math help. I just assumed you were a …A nerd?Well, I don 't know about that.Don't worry. I 'm not offended (no offence ------------ as weak as a cat (=as weak as water)). I 'm a nerd. But who says nerds can 't play drums?Unit 3A: So, Amy, how many kids do you and Tom have?B: Uh, kids, none, Not yet.A: Not yet? Did you say ”not yet ”? Hey, are you and Tom keepingscore here or what? You must be,what,35 by now. Clock 's a 'tickin 'Tick-tock, tick- tock, you know?B: Yeah, I think we 're aware of all that,but it 's kind of complicated. We 've got our careers right now, and A: Complicated? You think you 're the only people who are trying to juggle careers and family?B: No, no. I 'm sure we're not. Just, it 's kind of a personalthingA: So, Jerry, have you thought about where yo u're going to liveafter you graduate in June?B: Uh, yeah. I think I ' m going to move back in with my folks, save a little money, you know.A: Your folks ?You gotta be kidding !Don ' t you think it 's time to leave the nest?B:Uh, yeah, I guess. But it 's not like it 's gonna be forever. Just un til I can save up eno ugh money to ?…A:I gotta say, man, I think it 's a mistake.B: Well, I 've thought about it a lot, and I really think it 's the best decision for me right now.A: But you need to go out on your own ,get your ownplace ,find yourself. Your parents are just going to get in the way.B: Well, you know, I 'm not the only one moving back home after college. Seems like half the people I know are doing it.A: Excuse me ,ma 'am.B: Yes?A: Your son 's tantrum is distur bing everyone in the store.B:I know, I know. I 'm trying to calm him down. Bobby, please be I little good boy for Mommy. I 'll give you a nice ,yummy cookie if youstop crying.A: If you ask me, what ' s your son needs is a little good old - fashioned discipline. A nice spanking will do the job! You know what they say: Spare the rod and spoil the child!B: Listen. How I raise my son is none of your business. We don 't believe in using3 / 30Listening Task 部分+答案大验英验验验程学体听教3physical violence with our children.A: So, Luice, do you have anyone special in your life ?B: No. Not right now .It 's been a while since I 've dated anybody.A: Well, what have you doing about it? You know you can 't meet someone sitting at home on your couch on Friday nights eating chocolate ice cream. You 've got to get yourself out there , girl!B: Well , I don 't know. Meeting someone at a bar or club just isn 't for me.A:I know! I 'm fixing you up with a friend of mine. He 's perfect for you.B: That 's ok, I 'm not really into blind dates.A: Don't be ridiculous! You 're gotta love him!B: You know, I 'm not sure I really want to be dating anyoneright now.。
新编大学英语视听说book3Unit4听力答案及文本1Unit 4Part OneListening IFor many of you this will be your last year at university and now is the time for you to begin thinking seriously about your future careers. In order to give you as much help as possible, I have quoted a list of questions that you ought to ask yourself.First, "Have I got a clear knowledge of my abilities as well as my interests?" Be honest about your weaknesses as well as your strengths. Take a really good look at yourself and give real thought to the kind of person you are, and what kind of person you want to be.Second, "Do I know the kinds of occupations in which people like myself tend to find success and satisfaction?" Talk to people who have similar abilities and interests and who are already in the careers that interest you. You can gain some idea of what they consider to be important and challenging in those careers. Watch these people at work.Third, "Have I weighed carefully the immediate advantages against the long-term prospects offered by the jobs I am considering?" Will the occupation you select give you satisfaction in the years to come? Realize now the importance of education in all fields, technical and professional. Remember that chances of promotion are usually given to educated persons—other things being equal.Fourth, "Have I talked with my parents, my teachers and my headmaster?" Remember they have a lot of experience that you can benefit from. They can help you think about the jobs. Theycan stimulate you to give careful thought to what you really want to do, and offer useful suggestions about how you might take full advantage of your personal qualities and qualifications.Last, "How do I regard my job? Is it just a means of getting money to do the things that I want to do? Is the work important to my future happiness? Is it a combination of both?"The above questions and their answers should give you some better ideas about how you should start planning your career. Your life-long job cannot be approached in any kind of haphazard fashion. It must be considered carefully, examined from every angle, and talked over with those who know you and those who can help you in any way.Exercise 12、4、5、6、8Exercise 21. weaknesses2. similar abilities and interests / interest you/ important and challenging3. education/ promotion/ educated persons4. parents/ teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II(Here's a dialog between a woman whose job is to help people find jobs and a man looking for a job.)Woman: Look. Here's a job that might interest you.Man: What is it? Are you sure? The last job interview you sent me off to was a disaster.Woman: Well, look. It says they want a sales manager, and it looks like it's a big international company. That'd be good. Youmight get to travel.Man: What kind of company is it, though?Woman: Um, let's see. Yes, it's a textile company that seems to import from abroad. They say the salary is really good. They operate a system of paying you a basic salary and then offering you a sales commission on top of that. They say it is high. And oh, look! They give you a car to travel round in. That's not bad, is it?Man: Um, do they say anything about experience?Woman: Um, let's see. No, they want someone young with ambition and enthusiasm. Oh yes, they want graduates, so that's OK. You've been to university. Now what else? Let's see.Man: There must be some catch.Woman: No, the only thing is you have to travel, but then that's what the company car's for. Oh, and you have to be able to get on well with other people because it says you have to be good on a team.Man: Um, perhaps I'll have a closer look at that one.Exercise 11. D2. D3. A4. BExercise 21. import from abroad2. sales manager3. salary4. sales commission5. travel in6. experience7. university8. on a teamListening IIIInterviewer: Some people feel that their jobs are misunderstood by others. Is that very common?Sociologist: Oh, absolutely. Most jobs or professions have an image or stereotype attached to them, and some of these are not realistic. The serious point is that young people choose their careers based on these false images, and they may even avoid certain careers which have a negative image. This can cause problems for the economy.Interviewer: Is there evidence of this problem?Sociologist: Yes, there was a recent survey of children's attitudes to different professions.Interviewer: How was this done? Children don't know much about jobs and professions.Sociologist: True. What the investigators wanted to get was children's impressions and prejudices. They gave the children twelve pairs of statements, one of the pair positive, and the other negative. Children were asked to say which of the statements was "most true" for each profession.Interviewer: For example?Sociologist: Well, for example, "Such and such a person is likely to be boring or interesting company."Interviewer: I see. What professions did they ask about?Sociologist: The list is long, but it included lawyers, economists, accountants, sales representatives, scientists and engineers.Interviewer: And the results?Sociologist: Well, they are striking, especially for engineerswho came out much worse than one might expect. About 90 percent of the children thought that engineering was a "dirty job", of "low status", and the engineer was more likely to take orders than to give them. The only other person they thought more likely to lose his job was the sales representative. But, there were good points too. Engineering was seen to be "interesting, well-paid work".Interviewer: Hmm, not a rosy picture.Sociologist: No, but it got better when children were asked what they thought of the engineer as a person. Most of them chose positive comments, but most thought the engineer was likely to be badly dressed.Interviewer: What about other professions? What were the most popular?Sociologist: Oh, the lawyers by far. Next came accountants and scientists as well as economists. The engineers and sales representatives were the least popular.Interviewer: Sounds like a sign of the times.Sociologist: Yes, but I think the most serious implication was the children's apparent ignorance of the importance of the engineer's role in society.Exercise 11. choose their careers2. avoid certain careers3.different professions4. impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. F3. T4. F5. TListening IVMegan: Tim, if you could pick any occupation in the world, what do you think would be a cool one?Tim: Well, truth be told, i think it would be pretty awesome to be a commercial fisherman. Megan: Fisherman! Why would you want to be a fisherman?Tim: Believe it or not, i’m really fascinated by the ocean. I like spending time in the ocean and I think if you go out on those boats and get away from the land, you really get in touch with the sea.Megan: Is it dangerous, though?Tim: Oh, it can be dangerous, for sure. You can get caught in storms. It can be rough sometimes.Megan: Do you get paid a lot of money?Tim: Not so much, but that is not necessarily vital. You know, you can work with nature. You can catch healthful food, provide for yourself, and I think that’s really fulfilling. How about you , Megan? What do you think would be a cool job?Megan: I think I would like to be a writer.Tim: Why is t hat? Lots of writers don’t succeed in making much of a living.Megan:Well, being a movie star would be exciting too, or a rock star, but the fame is overwhelming—too many peoplealways want to talk to you or want your autograph. I think as a writer, you are doing something you love without all that pressure or the media coming after you, and you can sort of make your own workk schedule and do it where you like. You can write in the countryside in a cabin, or you can write in the city wherever you please. So, I think it is a very flexible, rewarding job.Tim: Yeah, you’ve got to have the aptitude for it, though. Do you think you have what it takes?Megan: No, not yet. I’m a terrible writer. But anyway, if I could have my pick of jobs, I’d like to be a writer.Exercise 11. C2. A3. C4. B5. DExercise 21. occupation, cool2. catch, provide, fulfilling3. media coming after you, making your own work schedule4. have my pick of jobsPart 4Further ListeningListening IThere are at least 100 million workers in the Unites States. Most of them are on the job 35 to 40 hours a week. Their typical day includes seven to eight hours of work. Usually, they have a 15-minute coffee break in the morning and in the afternoon. But work schedules vary from job to job.White-collar workers—office workers and manyprofessionals—usually have "nine to five" jobs. They begin at 9:00 a.m. and finish at 5:00 p.m. Monday through Friday. "Blue-collar" workers—mechanics, electricians, and laborers—often work from 8:00 a.m. to 4:00 p.m. In many factories, blue-collar workers come to work in eight-hour shifts. Typically, these shifts start at 8:00 a.m., 4:00 p.m., and midnight. Finally, sales people and managers in retail stores work on Monday and Thursday nights, when the stores are open. Many retail workers also work on Saturdays, and some work on Sundays.These are the normal schedules for most American workers. However, many businesses now use a new system called "flex-time scheduling". Under this system, the employees choose their own working hours. Some people work from 8:00 to 4:00 five days a week. Some work from 9:00 to 5:00. Other people work 10 or 12 hours a day four days a week. Employees and managers are both happy with the system. The employees like the freedom of choice, so they work hard. The managers, of course, like the hard-working employees.What, then, is a typical work schedule? It depends on the job—and on the workers.Exercise:1. 100 million2. 35 to 403. 7 to 84. office workers, many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday ,Thursday, Saturdays ,Sundays8.choose their own working hours, freedom of choice , happy withListening IIMan: How long have you worked for AM-ADMEL, Gill?Woman: Only for a year. It's May now, isn't it? Yes, I joined last August in fact.Man: August in 1996.Woman: Yes.Man: What did you do before that?Woman: I used to work for a travel agency in London.Man: It was interesting, wasn't it?Woman: Not really. It was just secretarial work, rather like this job. And it wasn't too well-paid. But I took a secretarial course when I left school and I couldn't think what else to do.Man: So you went straight from school into a secretarial course, didn't you?Woman: Well, not quite. I left school when I was 16, in 1989, I think it was. And then I went to work in a hotel in Austria for a year, to learn some German.Man: Austria? Why Austria?Woman: I don't know really. Well, we used to go there on holiday quite often when we were younger, and, well, I like Austria actually. Anyway then I went back and did the secretarial course. That was a year's course.Man: And then you got the job at the travel agency I suppose.Woman: Yeah, that's right. That was in 1991.Man: So you were there for five years!Woman: Yes, it's awful, isn't it? Actually, I'm thinking of giving it all up to become a nurse.Man: Really?Woman: Well, I worked in a hospital in Twickenham during my last year at school. Just cleaning and helping to make bedsand so on. It was part of our Practical Careers training.Man: And you liked it?Woman: Yes, it was interesting.Exercise1. A2. D3. C4. A5. DListening IIIMan: Well, now then, one thing I'd like to ask is, er, exactly why you applied for the job. I mean, just looking at your application form, you're actually over-qualified...Woman: Yes, I thought you might ask that. Um, the thing is, in my present job, although I'm actually in charge of a small team and I have a lot of responsibility, it's largely a desk job with a lot of paperwork...Man: And you're not too keen on being stuck in an office all day?Woman: To be honest, no, I'm not. I much prefer being out on site where I can supervise things, and deal with problems as they occur. And this job should give me the kind of contact with other engineers, architects, builders and so on.Man: Mmm. You'd certainly have to do quite a lot of traveling in the local area, you know, visiting different sites. You do realize, though, that the starting salary isn't as good as the salary in your present job?Woman: Yes, I realize that, but um, it does say in the job advertisement that the promotion prospects are very good.Man: That's true, and er, as this is a new project that we'reworking on, we think there'll be a very good chance of fairly quick promotion, depending on performance, that is...Woman: Yes, of course. Well, you see, I've got very little chance of promotion in my present job.I mean it's a very small company and there's nowhere really for me to go; that's why I'm looking around for somewhere else.Exercise1. C2. B3. D4. C5. AListening IVDavid: Hi! You're listening to Radio Southwest, the best in the southwest for music andup-to-the-minute news. Sue's here. Hello, Sue.Sue: Hello, David.David: And we've got the Jobspot for you today. So, if you're looking for a new job, this could be the spot for you. So, let's have a look, and see what we've got today.Sue: Well, the first one we've got is a cook. That's in a large, busy restaurant, so it's very useful to have had experience in cooking. Must be a high school graduate and the pay is $12 an hour. So that's not bad, is it? The hours are good too. That's Monday to Friday, 3:00 p.m. till 6:00 p.m.David: Great. Thanks, Sue. So that's a cook. Now, how do you fancy working out of doors? How do you fancy being a gardener? So as long as you're fit and strong, and at least 16 years old, that'll suit you. The pay is $8 an hour. And the hours, Tuesday to Saturday, 8:30 a.m. to 5:00 p.m., you have to work on Sundayonce a month, but on Monday the Garden Center's closed. Now, the sort of work you'd be doing is potting, watering, things like that. So, how about applying for that? Pay, $8 an hour. Sue, what else have you got?Sue: Right, Dave. Well, from outdoors to indoors. We've got a word processor operator job here. This job might suit a woman with school-age children, because the hours are only 15 hours a week. It's a small, friendly office, and they require a high school graduate with two years' experience operating a computer. Pay is $9 per hour. So, there you go. That's a nice job in an office. If you fancy any of those jobs, give us a ring here on Jobspot at Radio Southwest. And now back to the music.Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACE。
新编大学英语视听说教程3听力标准答案Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly B Exercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved 10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being aware Exercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) English Part Four Testing Yourself1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C8. B Section III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneExercise 21. C3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening III Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw 7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.T Practice Two Exercise 11. C D J2. A E G H3. B F IExercise 2Practice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 1 1. B 2 . C 3. B 4. A 5. D 6. A Exercise 21. F2. F3. T4. T5.FPart Four Testing Yourself Section 11. C 2 . B 3. C 4. B 5. A 6. C Section II1. T2. F3. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7. F 8.F 9. T 10. FPart TwoListening I Exercise 12. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 2Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction 4) species5) oxygen 6) economic 7) conservation 8) valuable income 9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America, pet food, enough protein, develop2. much more, Asia ,Africa3. position, natural resources, gone down, steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house 5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ¥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and pre judices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 2Practice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happywith Section II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 1Exercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cards Practice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goals Exercise 21. T2. F3. T4. F5.TPractice Four Exercise 12. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by 10. sense 11. ourselves 12. inhabit Section II1. F2. T3. F4. T5.F6.T7.T8. TSection III2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. AExercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease 9. isolated/ company 10. storm of debate Part TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particular Exercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train 13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.DExercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing Yourself Section 12. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced14. export bans 15. importation 16. turtles Unit 7Part OneExercise 22. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. AExercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July 14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1 Advantages ADH Disadvantages E Exercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking8. convenient9. restaurants 10. bathrooms Exercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winter Practice Four Exercise 11) A 2) B 3) B 4) A 5) B 6) A 7) A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C5. A6. DSection III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5,7,1,4,6,3,2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship 11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13.careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 27. short 8. elbows 9. knees 10. size-14 11. lungs 12. heart Practice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars 10. scholars 11. street cleaners Practice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.F Practice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.TPart Four Testing Yourself Section 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior 14. fluently 15. read 16. exceptional 17. preparation 18. fully Section II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16. C 17. W 18.WExercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slower Exercise 21. T2. F3. F4. T5.T7. T8. F Listening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the strings5. manages the bowExercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. T Exercise 2Bruce Springsteen: communicative, direct, exciting, simpler Sting: naturalPeter Gabriel:musicalBranford Marsalis: brilliant, humorousYoussou N’Dour:not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing Yourself Section 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen8. arms9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. T Exercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying 10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired 10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. T Exercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeks Practice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damagedExercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days8. give up9. stop trying 10. encounter risks 11. to be brave 12. shut 13. give 14. hold 15. wings 16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. ASection II 1. C 2. B 3. D 4.A 5. BSection III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black 11. white 12. shaking 13. wet 14. sweet 15. delicious 16. angel 17. grave 18. nights 19. days 20. taste。
新编大学英语视听说 book3 Unit 6听力答案与文本1Unit 6Part 1Listening IWoman: Why do you think people are afraid of tarantulasMan: Well, I guess it's because people are afraid of all spiders, and tarantulas happen to be the biggest of all the spiders. And maybe it's also because some spiders really are very poisonous. In California, for example—in most of the garages in California—you get black widows, which are quite small but certainly more dangerous than tarantulas. Woman: But personally you aren't afraid of tarantulasMan: Well, I shouldn't be frightened of tarantulas, simply because I know that they aren't really dangerous —all they can do is give you a small bite, but it's not poisonous. And yet I must say I don't like to pick them up. But you see, some people keep pet mice and pet rabbits and, well, they can give you a much worse bitethan a tarantula ever could. And yet people aren't frightened of them.Woman: Why do you think people are frightened of spidersMan: I don't know—it's very strange. People are frightened of spiders and they are frightened of snakes, and, well, obviously some spiders and some snakes really are poisonous. But most snakes are harmless, and it's really strange that people are so frightened of spiders because it's quite difficult to find a spider that's really dangerous.Exercise 11. B2. C3. D4. B Exercise 21. T2. F3. F4. FListening IIShop Assistant: Good afternoon, madam. Can I help youCustomer: Yes. I'm looking for a pet for my son. Can you suggest anythingShop Assistant: What kind of pet does he want A traditional pet, a cat...or a dog Or something unusual Customer: Well, he'd like a snake or a crocodile,but he isn't going to get one. Shop Assistant: We've got a nice Alsatian at the moment.Customer: An Alsatian Did you say \They're very big and savage.Shop Assistant: Oh, no, madam. They aren't as savage as some dogs. Customer: ReallyShop Assistant: Oh, yes. Last week we had a small dog. It was only as big as your handbag, but it was as savage as a tiger—it bit me three times! Customer: Perhaps not a dog, then. Shop Assistant: How about a catCustomer: A cat Hmm...they aren't as friendly as dogs, are theyShop Assistant: No, but they don't eat as much as dogs either. And they're very clean. They wash themselves every day. Customer: Hmm...Shop Assistant: Or how about a bird A parrot or a budgie We have both. Customer: Which do you rexxmend Shop Assistant: Well, budgies aren't as easy to train and they never speak as well as parrots. Customer: Yes, but budgies don't need as much space as parrots, do theyShop Assistant: That's true. Budgies are very popular because they are so easy to keep. Customer: Yes...but they're a bit noisy, aren't they I want a quiet pet.Shop Assistant: A quiet pet Well, how about a goldfish There's nothing as quiet as a goldfish.Exercise 11. snake, crocodile2. parrot, budgie3. quiet4. goldfish Exercise 21. A2. D3. A4. C5. AListening IIIOver 450 wild horses have been killed in Nevada. The land they were on belonged to thegovernment. Some people say it is worse than when all the buffaloes were killed. Many of the horses were shot while running.Wild horses are protected by law. 28 thousand wild horses share the land with six million cattle. Cattlemen say the horses are crowding the cattle out. It is said that there is a war going on. Both the cattle and the horses need the water and grass that is on the land.The president of the Nevada cattleman group also helps to protect the horses. He says that he does not like what is happening to the horses. He does want the government to help keep the number of horses low.Some people think the Navy used the wild horses for target practice. Pilots flew over the area where the horses were found. The Navy said that they did not let their pilots do that.The horses were found far from the nearest road. The killings happened over a large area. It has been happening for the last two years.Some people think that the horses should be gotten rid of. Others think that they should stay. In the meantime, the police will try to figure out who killed the horses. Questions:animal has been killed in Nevada recently is the number of the animals killed long has the killing lasted did the killingExercise 11. C2. A3. BExercise 21. crowding , war, water, grass2. what ishappening, keep the number of horses low 3. target practice, where the horses were found 4. gotten rid of , stayListening IVNarrator: I'm going to tell you about an extraordinary thing that happened the day before yesterday, about eight o'clock at night, a young woman approached the box office of the best movie theater in the city. She had with her an enormous dog with a beautifully groomed coat. She bought two tickets and went toward the door, followed by her dog. The manager of the theater spoke to her...Manager: I'm sorry, Miss, but dogs aren't allowed in this theater. Girl: But I have a ticket for him.Manager: I'm very sorry, but animals aren't permitted.Girl: You don't understand. This is a special case. My dog is so well trained and so intelligent that he's almost human.Manager: I see that you have an exceptional animal, but...Girl: I promise you that if there is any problemwe'll leave the theater immediately. I assure you that this dog isn't like any other dog you've ever seen.Manager: Well, all right. I'll let you go in, since the theater is almost empty tonight. Nevertheless, your dog will have to behave himself, or you will have to leave.Narrator: About two hours later, and now the people are leaving the theater. The manager sees the girl with her dog.Manager: I congratulate you. You are right; your dog behaved very well. I've been watching him, and it's amazing how quiet he was.Girl: I told you that he's well trained and very intelligent.Manager: He certainly is. It even seemed as if he was enjoying the movie.Girl: Oh, he did enjoy it. He liked the film very much. However, he liked the book much better. Exercise 11. F2. T3. F4. T 8. F Exercise 2 4 6Part 2Exercise 11. D2. A3. B4. C5. C6. A Exercise 21. farm animals, hold, feed2. small pets, toys3. bury, toss them out4. real shame5. dangerous, destructive, bring diseases6. havea point 7. humanely, limit8. time, money, warm place 9. isolated, xxpany 10. storm of debatePart 3Exercise 11. A2. D3. D4. B5. A6. C7. A8. B Exercise 21. female, collectively2. not a moment3. infinite care up, left to right 5. struck, smarter 6. salt water lake, dock 7. self-aware, non-human intelligence, belong in captivityPart 4Further listening Listening 1Many people around the world bexxe friends with animals. Some call their pet animals byhuman names. They treat them like members of thefamily. Scientists now are proving what many pet owners already know—pets are good for your health.The Delta Society is a research center in the northwestern state of Washington. They say animals have a healthy effect on people, especially people who are sick and lonely.Several years ago, the Delta Society developed a program called \people work in pet therapy programs throughout the country. They take animals to visit people in hospitals, prisons and private homes. Dogs and cats are taken most often. But other visitors include snakes, rabbits, horses and birds. Some of the animals stay with the people forever. The dolphin also has a good effect on people. Scientists at the Dolphin Research Center in Florida introduce sick people to playful dolphins. People feed the dolphins, touch them, and ride on the dolphins' backs in the water. In this way, the animals help the patients feel better.The head of the Delta Society, Linda Hines, says one reason for the pet therapy is that animals help sick people get better. Also, she says the animals have a calming effect on people, because pets can help peopleforget their own problems.Exercise 1 1. Exercise 21. A2. C3. C4. AListening II1Unit 6Part 1Listening IWoman: Why do you think people are afraid of tarantulasMan: Well, I guess it's because people are afraid of all spiders, and tarantulas happen to be the biggest of all the spiders. And maybe it's also because some spiders really are very poisonous. In California, for example—in most of the garages in California—you get black widows, which are quite small but certainly more dangerous than tarantulas. Woman: But personally you aren't afraid of tarantulasMan: Well, I shouldn't be frightened of tarantulas, simply because I know that they aren't really dangerous —all they can do is give you a small bite, but it's not poisonous. And yet I must say I don't like to pick them up. But you see, some people keep pet mice and petrabbits and, well, they can give you a much worse bite than a tarantula ever could. And yet people aren't frightened of them.Woman: Why do you think people are frightened of spidersMan: I don't know—it's very strange. People are frightened of spiders and they are frightened of snakes, and, well, obviously some spiders and some snakes really are poisonous. But most snakes are harmless, and it's really strange that people are so frightened of spiders because it's quite difficult to find a spider that's really dangerous.Exercise 11. B2. C3. D4. B Exercise 21. T2. F3. F4. FListening IIShop Assistant: Good afternoon, madam. Can I help youCustomer: Yes. I'm looking for a pet for my son. Can you suggest anythingShop Assistant: What kind of pet does he want A traditional pet, a cat...or a dog Or something unusualCustomer: Well, he'd like a snake or a crocodile, but he isn't going to get one. Shop Assistant: We've got a nice Alsatian at the moment.Customer: An Alsatian Did you say \They're very big and savage.Shop Assistant: Oh, no, madam. They aren't as savage as some dogs. Customer: ReallyShop Assistant: Oh, yes. Last week we had a small dog. It was only as big as your handbag, but it was as savage as a tiger—it bit me three times! Customer: Perhaps not a dog, then. Shop Assistant: How about a catCustomer: A cat Hmm...they aren't as friendly as dogs, are theyShop Assistant: No, but they don't eat as much as dogs either. And they're very clean. They wash themselves every day. Customer: Hmm...Shop Assistant: Or how about a bird A parrot or a budgie We have both. Customer: Which do you rexxmend Shop Assistant: Well, budgies aren't as easy to train and they never speak as well as parrots. Customer: Yes, but budgies don't need as much space asparrots, do theyShop Assistant: That's true. Budgies are very popular because they are so easy to keep. Customer: Yes...but they're a bit noisy, aren't they I want a quiet pet.Shop Assistant: A quiet pet Well, how about a goldfish There's nothing as quiet as a goldfish.Exercise 11. snake, crocodile2. parrot, budgie3. quiet4. goldfish Exercise 21. A2. D3. A4. C5. AListening IIIOver 450 wild horses have been killed in Nevada. The land they were on belonged to thegovernment. Some people say it is worse than when all the buffaloes were killed. Many of the horses were shot while running.Wild horses are protected by law. 28 thousand wild horses share the land with six million cattle. Cattlemen say the horses are crowding the cattle out. It is said that there is a war going on. Both the cattle and the horses need the water and grass that is on theland.The president of the Nevada cattleman group also helps to protect the horses. He says that he does not like what is happening to the horses. He does want the government to help keep the number of horses low.Some people think the Navy used the wild horses for target practice. Pilots flew over the area where the horses were found. The Navy said that they did not let their pilots do that.The horses were found far from the nearest road. The killings happened over a large area. It has been happening for the last two years.Some people think that the horses should be gotten rid of. Others think that they should stay. In the meantime, the police will try to figure out who killed the horses. Questions:animal has been killed in Nevada recently is the number of the animals killed long has the killing lasted did the killingExercise 11. C2. A3. BExercise 21. crowding , war, water, grass2. what is happening, keep the number of horses low3. target practice, where the horses were found4. gotten rid of , stayListening IVNarrator: I'm going to tell you about an extraordinary thing that happened the day before yesterday, about eight o'clock at night, a young woman approached the box office of the best movie theater in the city. She had with her an enormous dog with a beautifully groomed coat. She bought two tickets and went toward the door, followed by her dog. The manager of the theater spoke to her...Manager: I'm sorry, Miss, but dogs aren't allowed in this theater. Girl: But I have a ticket for him.Manager: I'm very sorry, but animals aren't permitted.Girl: You don't understand. This is a special case. My dog is so well trained and so intelligent that he's almost human.Manager: I see that you have an exceptional animal, but...Girl: I promise you that if there is any problem we'll leave the theater immediately. I assure you that this dog isn't like any other dog you've ever seen.Manager: Well, all right. I'll let you go in, since the theater is almost empty tonight. Nevertheless, your dog will have to behave himself, or you will have to leave.Narrator: About two hours later, and now the people are leaving the theater. The manager sees the girl with her dog.Manager: I congratulate you. You are right; your dog behaved very well. I've been watching him, and it's amazing how quiet he was.Girl: I told you that he's well trained and very intelligent.Manager: He certainly is. It even seemed as if he was enjoying the movie.Girl: Oh, he did enjoy it. He liked the film very much. However, he liked the book much better. Exercise 11. F2. T3. F4. T 8. F Exercise 2 4 6Part 2Exercise 11. D2. A3. B4. C5. C6. A Exercise 21. farm animals, hold, feed2. small pets, toys3. bury, toss them out4. real shame5. dangerous, destructive, bring diseases6. havea point 7. humanely, limit8. time, money, warm place 9. isolated, xxpany 10. storm of debatePart 3Exercise 11. A2. D3. D4. B5. A6. C7. A8. B Exercise 21. female, collectively2. not a moment3. infinite care up, left to right 5. struck, smarter 6. salt water lake, dock 7. self-aware, non-human intelligence, belong in captivityPart 4Further listening Listening 1Many people around the world bexxe friends with animals. Some call their pet animals byhuman names. They treat them like members of the family. Scientists now are proving what many pet owners already know—pets are good for your health.The Delta Society is a research center in the northwestern state of Washington. They say animals have a healthy effect on people, especially people who are sick and lonely.Several years ago, the Delta Society developed a program called \people work in pet therapy programs throughout the country. They take animals to visit people in hospitals, prisons and private homes. Dogs and cats are taken most often. But other visitors include snakes, rabbits, horses and birds. Some of the animals stay with the people forever. The dolphin also has a good effect on people. Scientists at the Dolphin Research Center in Florida introduce sick people to playful dolphins. People feed the dolphins, touch them, and ride on the dolphins' backs in the water. In this way, the animals help the patients feel better.The head of the Delta Society, Linda Hines, says one reason for the pet therapy is that animals help sick people get better. Also, she says the animals have acalming effect on people, because pets can help people forget their own problems.Exercise 1 1. Exercise 21. A2. C3. C4. AListening II。
大学英语教材视听说3答案Unit 1: 家庭生活Listening ComprehensionPart 1: Short Dialogues1. A) She has a lot of work to do. B) She has to take care of her sick grandmother.2. A) He didn't watch the TV show. B) He thinks the TV show is boring.3. A) He's reading a book. B) He likes reading books in the library.4. A) At a restaurant. B) They ate a meal.5. A) She doesn't like her new job. B) The job is too difficult for her.Part 2: Long Dialogue6. A) She is too busy with her coursework. B) She hasn't had any time to relax.7. A) It's at the city center. B) It is very convenient for everyone.8. A) She has lived there for two years. B) She thinks the neighborhood is safe.9. A) They were talking about their plans for the weekend. B) They decided to go hiking in the mountains.10. A) She is not good at sports. B) She prefers reading books instead.Part 3: Passages11. B) The importance of a healthy diet.12. C) The benefits of regular exercise.13. A) The negative effects of stress on health.14. B) The importance of a good night's sleep.15. C) The significance of maintaining good mental health.SpeakingPart 1: Personal Experience1. I often communicate with my family members through video calls or texting apps.2. Yes, it is. It helps me to save time and money, especially when I cannot meet them in person.3. I try to schedule regular family gatherings or plan trips together to maintain the bond.4. Yes, I think it is important to have regular communication with family members no matter how busy we are.Part 2: Expressing Opinions1. Personally, I prefer traveling with friends because we can share the excitement and create memories together.2. I think studying in a group is more effective because we can learn from each other and help each other with difficult concepts.3. In my opinion, participating in extracurricular activities is beneficial as it helps to develop various skills and make new friends.Part 3: Describing Pictures1. The picture shows two friends having a picnic in a park. They are sitting on a blanket and enjoying their meal.2. The picture depicts a group of students studying together in a library. They are reading books and discussing the lessons.3. The picture illustrates a person doing yoga in a peaceful setting, surrounded by nature. They are in a meditative posture.Part 4: Role PlayA: Can you recommend a good restaurant near here?B: Sure! There's a famous seafood restaurant just a few blocks away. Would you like me to show you the way?A: That would be great! Thank you.B: You're welcome. Let's go now, it's not far.Reading ComprehensionPart 1: Multiple Choice1. A) 6 weeks.2. C) By discussing their viewpoints.3. B) It helps improve blood circulation.4. A) It reduces the risk of heart disease.5. C) Relaxing the mind.Part 2: True or False1. True2. False3. False4. True5. TruePart 3: Matching1. G2. C3. B4. F5. A6. E7. DPart 4: Sentence Completion1. healthy and balanced diet2. practice regular physical exercise3. manage and reduce stress4. get enough sleep5. maintain good mental well-beingWritingExercise 1: Write a short paragraph (40-50 words) about your favorite hobby.My favorite hobby is playing the guitar. I enjoy strumming the strings and creating melodious tunes. It helps me relax and express my emotions. I have been playing for a few years and it brings me a great sense of fulfillment.Exercise 2: Write a short paragraph (40-50 words) explaining the importance of time management.Time management is crucial for success in both personal and professional life. It helps us prioritize tasks, increase productivity, and reduce stress. By effectively planning and organizing our time, we can accomplish more and have a better work-life balance.Note: The above answers are based on standardized material and may vary depending on the specific edition or version of the English textbook "视听说3".。
UNIT 3Part 11. 52. 43. 11. apartment2. heater3. air conditioning4. hookup a washer and dryer5. have a yard6. we have a small balcony7.the best thing about our apartment is that it is located in a safe neighborhood with lots of young families8. allow9. I want a place with air conditioning and washer/dryer hookups10. A garage to keep our cars. someday we hope to move into the house of our dreamsPart 21. B2. B3. AMaryanne: I think it’s time to move. This apartment is too smallVu: I’m making more money now. I think we can afford a bigger place. Maryanne: Not so fast. We are not that rich. B \ ut it is hard with all four of you sharing one room. We need one bedroom for the girls and one for the boys.Vu: Yes. A three-bedroom. Nga and Truc take hours to do their hair! Maryanne: We don’t have air conditioning. I want air conditioning in the new place.Vu: Air conditioning would be really nice. It gets so hot in the summer. Truyen: Can we get a pool too?Vu: Well, we don’t really need a pool. Well, let’s try to find a place that has one.Truyen: Don’t forget we need a yard for the dog. We don’t have one now. Maryanne: Of course, we want a nice space for Fluffy.Vu: Let’s get the paper and start looking for a place today!1.Dose Sam hope to buy a new home for his mother?2.Do the children like to play in their new yard?3.Does the roof on the building need to be repaired?4.Do Alex and Logan have a two-bedroom apartment?5.Do you live near the freeway and the college?6.Did the Internet have the best classified ads?7.Does their family like the safe neighborhood they live in?8.Does Dana want a place with a yard for her puppies?Part 31. a couple of2. To confirm that everything’s in order3. A washer, dryer and refrigerator will be provided for you4. Get a bigger fridge5. Do with6. We don’t nind, just as long as it works7. This will be refunded to you if the apartment is in good condition when you leave8. Need it fixed?Part 41. b2. d3. cElectricity1758 Hermosa Avenue97655 Beach RoadMarch 7thMarch 9thPart 5Tenant: Hello, Mr. / Mrs. Jones. This is Jonh in apartment 3B. Landlord: Hi, John. What can I do for you?Tenant: The air conditioning in our apartment is not working. Landlord: OK, I will send a repairperson over to fix it tomorrow. Tenant: Thanks1. While I was making dinner2. The electricity went out while I was studying3. The faucet was dripping all night4. The neighbors were shouting, and their dog was barking Part 61. To protect yourself2. Sign the rental agreement3. Read it very carefully4. List restrictions on guests or pets5. Fix a broken toilet6. Agreed to fix the problem7. In person8. Keep their buildings clean and in good condition9. It is your right as a tenant to have a comfortable and safe place to live1. F2. T3. F4. TPart 7Maryanne: Now you are making more money, I think we need to make a new budgetVu: OK, let’s talk about income first. With the raise, my income will be $3,000 a month.Maryanne: Great! And with my part-time job, I’m still making about$1000 a month.Vu: OK, that’s it for income. The rent for our new apartment is going to be $1350 a month. It’s a bigger place, so our utilities are going to go up. Maryanne: Yeah, I was thinking our gas bill will probably be around $40 a month and our electricity will be about $60 especially with that air conditioning.Vu: That sounds about right. What about the phone, cable, and Internet? Maryanne: Well, if we use the same companies, they’ll be the same Vu: Is the phone bill really $65 a month?Maryanne: Yes, it’s an average. It includes long—distance calls to your mom in Vietnam.Vu: I see. How much do you spend on groceries each month? Maryanne: About $450. That shouldn’t change. Urn, what do we spend on the car?Vu: Good news. We paid off the loan last month. Now the only expense is gas and maintenance.Maryanne: Right. Let’s budget $150 for thatVu: OK, well, it looks like we’ve got some extra money. Let’s talk about how we can use it1. $10002. $40003. $13504. $405. $4506. $1507. 08. $21759. $1825Maryanne: Now you are making more money, I think we need to make a new budgetVu: OK, let’s talk about income first. With the raise, my income will be $3,000 a month.Maryanne: Great! And with my part-time job, I’m still making about $1000 a month.Vu: OK, that’s it for income. The rent for our new apartment is going to be $1350 a month. It’s a bigger place, so our utilities are going to go up. Maryanne: Yeah, I was thinking our gas bill will probably be around $40 a month and our electricity will be about $60 especially with that air conditioning.Vu: That sounds about right. What about the phone, cable, and Internet? Maryanne: Well, if we use the same companies, they’ll be the same Vu: Is the phone bill really $65 a month?Maryanne: Yes, it’s an average. It includes long—distance calls to your mom in Vietnam.Vu: I see. How much do you spend on groceries each month? Maryanne: About $450. That shouldn’t change. Urn, what do we spend on the car?Vu: Good news. We paid off the loan last month. Now the only expense is gas and maintenance.Maryanne: Right. Let’s budget $150 for thatVu: OK, well, it looks like we’ve got some extra money. Let’s talk about how we can use it1. Now that2. Utilities3. Be around4. Be about5. All other expenses should stay the same, shouldn’t they6. Seeing that we paid off the car loan last month7. We’ll have some extra money8. Need to put money away9. Be able to send10. They’ve been eyeing for ages11. Help them out12. Maybe we can start saving for the honeymoon we never went onVu: now that we’re in a bigger place, our utilities are going to go up. Maryanne: Yeah, I was thinking our gas bill will probably be around $40 a month and our electricity will be about $60Vu:Ok, all other expenses should stay the same, shouldn’t they? Groceries, phone, cable and the Internet?Maryanne: If we use the same companies, they’ll be the same. Groceries should stay the same too.Vu: Great. And seeing that we paid off the car loan last month, we’ll have some extra money.Maryanne: Oh, that’s good news! We’ll still need to put money away for the children’s education, like we’ve always done.Vu: Yes, and we’ll be able to send more money over to Mom. There’s a plot of land that they’ve been eyeing for ages and I’d really like to help them out.Maryanne:Yes, we should. And after that’s done, maybe we can start saving for the honeymoon we never went on.Vu: I know, Maryanne. That’s something we should definitely do.Unit4Part11. How’s everything2. Makes it even harder3. Need to know4. Open a checking account5. Pay my bills6. It’s about two blocks from here7. My car and renew my driver’s license8. Take a bus9. How often the buses run10. You usually don’t have to wait more than ten minutes11. How much does a single trip to City Hall cost12. Closes for lunchPart 21.express with direct deposit2.standard without direct deposit3.premiere account with direct deposit1. Calling our automated information system2. Have indicated3. Checking accounts4. To decide which account is right for you5. At bank of the Century we offer four different checking accounts-Primo checking, ATM checking, Satndard checking and Access checking$22 $0 $12/$10 $14/$12 $26 $7 / / Unlimited 25 checks/m Unlimited Unlimited Unlimited UnlimitedUnlimited $6 service fee twoNo minimum balance noneOther information for Primo and Access:Primo: There is no monthly service fee if your combined balance at our bank is at least $10,000.Access: These is no minimum balance requiredPart 31. F2. T3. T4. F5. F6. F7. T8. F9. T10. F1. Join in2. Make you a library card3. Driver’s license4. Fill in this form5. e-mail6. no charge7. choose to book a terminal8. the public access computers9. check out10. keep them longer11. renew12. over the phone13. recommend14. help suggest15. spend1.$55.002.$10.003.$10.004.$2.005.$45.00 Part 41.6972.7093.7214.6245.362,740,7411.g2.f3.h4.e5.c6.b7.a8.dM: Do you know our teacher’s office number? W: Yes. Do you want it?M: yes.W: Let me see. It’s 344-476-0090M: And his mobile number?W: Let me check. It’s 130-476-0090M: ThanksPart 51.It is about 23-24 miles2.563.Northeast/southwest.4.Northwest5.Northwest6.It is about 38-40 miles7.Southwest1.Oak Street Hotel2.Japanese Restaurant1.start at the subway on 5th Avenue. Take a right out of the subway. Turnleft on Main street. Go straight for four blocks. Take a left on 1st Avenue. It’s on the corner of Oak and First Avenue. What’s the name of the building?2.start at the post office on Main Street. Turn right out of the post office.Turn left on 3rd Avenue. Go straight for two blocks. It’s on the corner of Maple Street and 3rd Avenue. What’s the name of the building?Most people in our country live in urban areas. Urban areas are made up of cities and their surrounding suburbs. Urban areas have large populations and tall buildings. People live in many neighborhoods and work different kinds of jobs. The transportation system around these neighborhoods is well developed and very convenient. People get up very early to catch all kinds of transportation for work such as the subway and the bus. In addition, there is also carpooling, which is especially popular among young people. In a word, life in the urban area is both challenging and wonderful.1.B2.A3.DPart 61. Woke up2. Ready for3. Left for4. Ironed5. Made my list of errands6. Returned7. Stopped by8. Make a deposit9. Mail a package10. Grocery shopping11. Remembered to go to the cleaners and pick up some skirts12. Finished shopping8 42 73 510 69 11.F3.F4.TPart 71. One important difference is size2. A small community is called a town. A very small community is sometimes called a village3. Provide4. The surrounding area5. Rural areas6. Far apart7. A city is a very large community8. A large city usually is surrounded by smaller9. Open space10. A city and its suburbs make up an urban area11. The location, or place, of a community makes a difference in the kind of work people do12. A logging community13. Cutting trees and hauling logs1.F3.T4.F5.T。
视听说3完整版详细答案第一单元12/19 take a break why not some other time party available listen without talk to you about researching background work on hoping for break may be it By the way1A/5 she doesn’t work…… her sch…… she has…… she didnot…… she often1B/5 kind of it’s about right I did past three years paid of earned break the case in comparison to depends on a lot harder in general my roommate way too for myself a balance 2A/5 confident relaxed tense in a bad mood2B/5 1)How about 2)too 3)Why don’t 4)enough 5)Let’s 6)to walk3/5 1)am taking 2)work 3)have 4)am writing5/5 sorry I don’t I’m sorry That’d be ——第二单元3/19 money Goss They this on nick8/19 couldn’t has lost won’t-10/19 Tali Make HeNew story she can’t believe11/19 Nick too Talia doesn’t might not be12/19 get expert run broadcast competition In fact Speaking ought to give away Good thinking handle care audio expert fast on it You do hard to believe wake up smell the coffee crazy famous taking a bribe smart I hope get in the way work on 1A/5 alittle There thought would1B/5 heard about was caught they say what to think stuff you’d like to really convinced actually natural athlete in the season any opinion about disqualify for the sake of shame to in trouble with start rumors 2楼2A/5 连线arise对come up what对what that’s对that2B/5 trus croo bogus authentic3/5 Have have ever ought lately You’d better5/5 Idon’t wow They say Ap hey you You’re第三单元3/19 Nick career star8/19 More not the nike10/19 1\The audio 2\Don’t be 3\最长的 4\to go and talk11/19 hasn’t finish he it nay trick her12/19 Bad news audio expert check urgent be sure absolutely sure have an idea may remember confide in reporter researcher chance lose one more day only one more day won’t be sorry story get tell me everything deserve a break storycharming charm out of1A/5 They didn’t she didn’t she needed pop corn It’s a story1B/5 1)was thinking 2)That would be ok 3)this new mall 4)having a sale 5)kind of 6)a whole lot less 7)just really 8)endup using little 9)Well 10)little girl 11)the whale 12)sounded really good 13)a lot 14)a lot less 15)you know what 16) treat you to2A/5 1)figure it out 2)investigate 3) result 4)make sense 5)ruined2B/5 urg对very to put对risk Sem对one of charm对to persuade3A/5 Talia对is able to she tell对be able to Tony对is not able Talia对is able 3B/5 yours mine5/5 I have an well,Idon’t If you Do you What do it’s worth Let’s go第四单元2/1 9 the asked her :so: he rent her a little N ick8/19 diffcult amusing dis English gland10/19 They could Did He think all To win3楼11/19 doesn’t he can he wants angry12/19 isten your side of the story Nope all alike judgeme trust only goal helping win deal with mess chargesserious threw a game gambling debts gave access to stop from Did you or didn’t you throw the game get show viewers Take your pick innocent1A/5Those Recently Time doesn’t He works He looks really 1B/5 ran into my gosh doing fantastic the same old howexciting perfect for or something like thata boring job gets to telemarketing telephone company2A/5 allow plan jour a part2B/5 Take a pick /T ake it easy/Take your time /Take a look3A/5 aa the a3B/5 aren’t /will you/does she/could he/hasn’t he/doesn’t she/didn’t I/wasn’t he5/5 I think I know you How have you been No,I’m sorry I’m afraid you’ve got It was great Here’s my card 单元测试1/3How did对He no longer when对when2/3 Nick对Which story Nick对the same3/3 The announce ……plays The announce talks about poetry……identifics1/3 in a bad mood /exhausted2/3 trustworthy/dishonest3/3 disgraceful action relax not guilty be……sense of planto don’t hurry1/3 are am Let’s go too much Why don’t I4楼2/3 received am going to ever should ’d better3/3 aren’t you an was the have seen good my am ableto dfferent haven’t2/5 serious talk busy3/5 different same different5/5 rising risingSPEAKING1/3I’m sorry it sounds I just don’t that would be That sound really good 3/3If you Iwill spend That’s Ijust Let’s 第五单元3/19 It’s im He was Shy8/19 very she plays he anything she wants Nick to know unbelievable 10/19 He’s not He Nick He’s getting11/19 I’would Talia shocked annoyed12/19sure sounds like stupid a minute deliberately from college works for recognize teammate bothexcuse us media you’ve got that right get it worry you getting some pressure sit out badlyfrankly win without you1A/5 call Her she couldn’t 100 A little1B/5 the whole story on the phone this rebate A hundred dollars supposed to of the camera nice aboutit serial number is gone Oh man 8002A/5become excit succ…… like begin2B/5 1)do you feel 2)do you think 3)are loving 4)such 5)so 6)believe2009-11-21 10:125楼3/5 so /such a /so /such /so /such a5/5 1)can I ask you to take a2)I have to take care of3)I’m tied uo at the moment4)Would you mind if5)Can you please check6)OK,no problem7)please fill this form第六单元3/19 She was No the result Talia8/19 1\Nick put50000 into hisbank account 2\she believes 3\he owes 4\making money 5\people 6\Ibel that 7\can’t 9/16 keep investigating have no choice going with beat us to it You’ve got to admit missing something asthey seem in this case too trusting skeptical all right working on fair let my emotions color myjudgment let me down won’t be sorry10/19 speptical He believes should work The bank11/19 they have to some want Dony1A/5 are allow Wise stop ID Dany1B/5 says at bars to have their parents thirteen years old get drunk you know drinking irresponsiblytheir kids baby-sitter bar owners this is happening crazy2A/5 Take对we have we don’t 对we decide For对For one we never对we are 2B/5 1)deposited 2)bank account 3)As a matter of fact 4)Take it from me 5)For one thing 6)except for 7)go with 8)beat us to it 9)let us down6楼3A/5 going/talking/eating/yourselves/myself/had known/would have brought/crying over /enjoying3B/5 1)may 2)may not 3)Is he 4)will 5)might not 6)may 7)aregoing to 8)might5/5 Do you think might perhaps It’s didn’t Is it possible that Nick didn’t take the money might第七单元3/19He explained 最长的 annoyed8/19 It’s brand He agreed Because+最长的By cheatingg Because he wants to amuse Talia Because angry she was angry Nick had not told here the truth10/19 He wasn’t going to tell A business woman TO visit To wear11/19 He was curius He will wear it would She want to ……truth12/19 here it comes juice bar Aren’t you Do I know you Not yet interesting proposition Keep goingLet’s say deal endorse athletic That’s it business card on second thought pay visit1A/5 They party+最长的 Thefirst job in it she wanted shemight Thefirst could go to earlier1B/5 great opportunity audition for such a wonderful show the same night other plays coming along so perfect so great about be invited go for it2A/5 They paid me so that Ichanged I want to know The shoes will becone Ok It doesn’t come and experience 2B/5 confirmed lines cone out basically endorsed3A/5 1)was taking 2)called 3)checked 4)was playing 5)quicker 6)more concentrated3B/5 would rather prefer to would prefer to2009-11-21 10:127楼5/5 soundslike fun or really? oh,really? Isee How awful How did it go Did you have a good?第八单元3/19she was trying Talia there was8/19 he meant to make meet jack hci had never jackie has neverworked Talia might G ower Buil ding Frustra show forten years10/19 Because she thought Nick had lied to her Neither she was very she used the recoptionst’s11/19 he enjoy finding show her anger she thinks confsed 12/19 dead for a moment angry yell at Maybe Probably guest dial in big trouble have trouble with used to memory to makematters worse ridiculous took lunch voice mail available odd telling thetruth lying see a good story1A/5 she asked for Try to she could meeting 4321B/5 looking for I mean quite a while at the desk Whatever Kind of hard for her name impossible totally screwed up pretty clear meet me lobby 4 o’clock good idea try where she is why don’t you how that goes2A/5 please wait sorry+短的 If you+长的Nick ……punished Tia+长的 The right now2B/5 odd Anyway In that case yell at ridiculous3A/5 where I can When the how much it what kind of used to3B/5 someone / used to /didn’t use to /something /anything /单元测试2LISTENING1/3Talia tells Nick that she believes him: {1.Nick meets Jackie baker8楼 2.Nick explains the deal he made to Talia.3.Talia decided to do see Jackie.2/3 1.The receptionist gives the office location.2.The receptionist gives the directions to the office.3.The receptionist asks for a signature3/3He had a health accepting He accepesVOCABULARY1/4get along get going2/4criticizing pressure3/4mutter feelforsomeone. fellfunn whisper4/4 skeptical asking tostep acknowledged down madeup approachable Let them off transfGRAMMER*/2 (Amy:Hi,Ronnie) 22111即 better were having more intelligent was listening would rather*/2 (Dear Mom) 12122即used to be somebody who that person is anybody where she lives PRONUNCIATION1/4cann’t can used2/4he /E/ her4/4 she up at 长的1/4 sorry to how was it?3/4 I really double it It’spossdidn’t I’m tired up oh,really? Ihave to take care of Did he have4/4 oh,really? How was That’s great第九单元3/19 5点 looking for There8/19 Because he needed the recept he was still Because hewondeved He wasn’t very He over To find 6点9楼10/19 Because he was trying Tell the she has blue he just 11/19 I’m confused help she never12/19 anything else someone else either In fact cheer up as bad as describe business suit excutive at all1A/5 she can bring cook for Go to Aby’s Emily’s1B/5 favor wondering bring two of my friends definitely supposed to messed up have a great time decorations last minutecooking things great to serve 6:30 three of you2A/5 the news+短的 Are you interest Hey, can may you +长的 I hend by she +短的2B/5business overheard follow describ cheer up3A/5 1)rushed 2)was checking 3)was playing went3B/5may as honest as as positive as can could as disgusting as5/5 sorry,but No,pr…… sure can I leave ma y be I can is it ok Do you第十单元3/1 9 The woman The inter……did not answer An……Dear8/19 he got into he made an he could not Things wer badly hewanted the woman the soccer the intertiew10/19 Dean’s They wear both she felt sorry she took10楼11/19 he wespec ts she has sarc…… sorry12/19around lately ran into admired ruining his career prettysure different changing the color wannabe tried outExcept for took lunch performance beginning to unfoldOn the house in his favor soccer professionally1A/5 do a survey noise is a the univer+长的 housing therre should1B/5 on behalf of a couple of minutes greatly appreciated more time building classrooms dorm roomsobviously point better quality more people at least pretty nice spacious rental houses stay in mixedfeelings involved in helps them out definitely issue2A/5will be get up stop to his unexp be made2B/5 uspended preformance catch up on on the house trying out3A/5 on with/out /up3B/5 losing /saying/ to need/ to wait3C/5 until/when/have5/5 Actually T o tell you what do you I’m not really 同上 If you ask Frankly第十一单元3/19 she think To tell How good8/19 he understand she joked……reporter upset she knowNick Nick she talks……party10/19 It’s nicer he’s going……happened no kick+长的11楼11/19she is angry she doesn’t Dean sorry,Nick12/19 won’t be sorry admit lied There you are are got reservations just around the corner doing business so much pleasant talkoverover lunch sign basically says endorse the shoes tricked out of the way next in line star player amazing team office make sure1A/5 Sunday write Next w…… 4:30 M……1B/5 are responsible for Africa visual aid in the outline easy look that up really quick have it all done due Wednesday needto meet I’m supposed to do compile get our project done off the Internet helpful use bring those in tomorrow2A/5They+短的 jose+短的 jack+长的 we+短的jane’s+短的2B/5 persuasive tricked persuade raise broke over out of this word3/5 went to see In orderto don’t have to help can’t to talk 5/5 I’ve got to is there anything Nothing I really need to Do you That’ll be第12单元3/19 To keep By working Nicknever had8/19 Nick is more To tell him he is That having money problem they have been hard to the so长的10/19 Surprisees长的He want’s ......truth To prove He didn’t (i)2009-11-21 10:1212楼11/19he is N ick’s tell Nick 长的 almost uncertain12/19buddy Tough rap really happened scheme talented plotting for dreamed up fake planning impressedtalking crazy expect figure out made up craziest stories pulledoff typical so sure of popular prove———-1A/5 she could she turned长的 A map of Africa Tuesday3小时 Teacher1B/5 the habitat of the animalsblue folder rest of the projectmap definitely different spotturned it in reliable sourcecoming to me instead of positively check with2/5 handed it in figured let you turn it3A/5 how long for since has been playing3B/5 figure them out help you out put them away clean it up the most expensive the best5/5 I’m not quite sure what you’re getting at. /Exactly./Do you mean that/NO,that’s not what I mean./ Could you go over it again? / Are you saying that测试LISTENING1/4 howdoes对He listened he wants to2/4 says he hasn’t heard of Kicks shoesto help Nickeye color3/4 Spread on the mustard:1.Put on the cheese and avocado.13楼 2. Put on the tomato and cucumber3.Add the secret ingredient.4/4 Gomez对if her team The team appearingVOCABULARY—————1/4 Marcello:Hi,Amy: pulled it off pass on2/4 Talia:Hi,Mom: Keep cool play it by ear3/4 come up with break down4/4 out of control out of this worldGRAMMER—————1/4 the luckiest pick him up best for dream this up2/4 Tony:So,Talia: think of working could start was doing as difficult as 3/4 Secretary: may to talk as easy as will give 4/4 interesting to buy surprised to invite havePRONUNCIATION1/5 up out2/5 I want to get and it3/5 single sound spr…… gl……4/5suprised going5/5 I have to has is —————SPEAKING1/3 Yes,what do you neeed I really need to2/3 Are you saping it Yes, that’s whatI mean3/3 Are you saying it didn’t go well Yes,that’s what Imean 过级最终测试Level Test—————listening1/5talia thinks…eliminated—the soccer teamthere is a rumor—has an injurytony thinks nick—a good soccer2/5what does the coach say the socer—they want nick not to palywhat does the coach ask to be—he doesn`t trustwhat dose nick say the tv station—he planned ahead3/5nick says his life is—a messnick says he needs—the newsdean doesn`t want to—comment about nicknick agreed to endorse—shoes4/5OK, I’m wondering…:couple sit-down silverware accommodateeasy-going understanding favor attractive settingsshe knows it’s kind of out of your way for us to go to this party Pick(注意大写) up anything else get somesome wine or dessert or bring anything5/5Alex.My old boyfriend Alex.:I looked really good toolook your bestNo way doing things and moving onhang out or somethingvocabulary1/6talia:i`mtry,but—truthamy:what`swrong,talia?—exhautedamy:you need to rest more—easy2/6which phrase means to want to do something?—feel like doing someting Which phrase means to understand something?—get itwhich word describes a loud way of speaking?—roar3/6dean:well i can tell you—reactionshoutthrough it4/6patty:he`s innocent—out of the waytalia:i know—dream uppatty:i can`t believe—wait and see5/6two boys were caught smoking—let them offexcuse us for a minute—asking to step asidethe government is tring to—downwe…for lost time by—made up6/6figure out—be able to come up withtake your time—don`t hurrythrow a game—plan to lose a sports gamegrammar1/4Tony:I(选词) : want am having would rather anyone better nick:i don`t know what to do—through itdean:i can`t believe all of—shout2/4dean:itink nick should—couldcoach:at first—was hoping3/4patty:well,i could add—hold on secondnick:thanks,i appreciate—best4/4talia:i…to see nick—havedean:why do you need to see him?—to talkdean:i think he`s too busy—concernedpronunciation1/6falling rising falling2/6forget debts talk3/6men{tion} ab{so}lutely4/6He…stuty—used to can’t5/6(br)eak (str)eet6/6looked—single sound talented—extra syllablespeaking1/2mark:what do you think about—frankly2/2but i`ve got one favor to ask you—ok.no problemhe was accused of taking drugs—yeah.absolutelyyou won`t believe who i ran into today—whoif you go shopping with me—that sounds goodyou studied so hard on the test—no.i didn`t prepare for it at all。
新交流英语视听说b3参考答案新交流英语视听说B3参考答案Unit 1: Daily LifeSection A: Listening Comprehension1. What is the main topic of the conversation?Answer: The main topic is about daily routines and activities.2. Why does the woman go to the gym?Answer: The woman goes to the gym to stay fit and healthy.3. What does the man usually do after work?Answer: The man usually goes to the library to read books after work.4. When does the woman usually have dinner?Answer: The woman usually has dinner at around 7 PM.5. What is the man's opinion about watching TV?Answer: The man thinks watching TV is a good way to relax but he doesn't watch it too much.Section B: Speaking1. Describe your daily routine.Answer: My daily routine starts with waking up at 6 AM, having breakfast, going to work, and returning home around 6 PM. I usually have dinner with my family and spend theevening either reading or watching TV.2. Do you think technology has changed the way we communicate? Answer: Yes, technology has significantly changed the way we communicate. We now rely more on digital communication methods like emails, social media, and instant messaging.3. How do you usually spend your weekends?Answer: On weekends, I like to spend time with my friends, go for a walk in the park, or sometimes just relax at home.Unit 2: Work and StudySection A: Listening Comprehension1. What is the man's occupation?Answer: The man is a software engineer.2. What does the woman do for a living?Answer: The woman is a teacher.3. Why does the man enjoy his job?Answer: The man enjoys his job because he likes solving complex problems and working with technology.4. What is the woman's opinion about her job?Answer: The woman finds her job rewarding because sheenjoys teaching and seeing her students learn and grow.5. How does the man plan to improve his skills?Answer: The man plans to attend workshops and take online courses to improve his skills.Section B: Speaking1. Discuss the importance of continuous learning in your field.Answer: Continuous learning is crucial in my field because technology is constantly evolving. To stay relevant, I need to update my knowledge and skills regularly.2. How do you handle stress at work?Answer: I handle stress at work by taking short breaks, practicing mindfulness, and maintaining a healthy work-life balance.3. What are some challenges you face in your studies?Answer: Some challenges I face in my studies include managing my time effectively, staying motivated, and keeping up with the workload.Unit 3: Travel and LeisureSection A: Listening Comprehension1. What is the main topic of the conversation?Answer: The main topic is about travel experiences and preferences.2. Where did the man go for his last vacation?Answer: The man went to Hawaii for his last vacation.3. What does the woman like to do when she travels?Answer: The woman likes to explore local cultures, try new foods, and take lots of photos.4. Why does the man prefer to travel alone?Answer: The man prefers to travel alone because he enjoys the freedom and flexibility it offers.5. What is the woman's opinion about group travel?Answer: The woman thinks group travel is fun and allowsfor shared experiences, but it can also be less flexible.Section B: Speaking1. Share your most memorable travel experience.Answer: My most memorable travel experience was visiting the Great Wall of China. The history and scale of the wall were awe-inspiring.2. What are some benefits of traveling?Answer: Traveling can broaden one's horizons, provide new perspectives, and create lasting memories.3. How do you plan your trips?Answer: I plan my trips by researching the destination, creating an itinerary, and setting a budget. I also make sure to include some free time for spontaneous activities.Unit 4: Current EventsSection A: Listening Comprehension1. What is the main topic of the news report?Answer: The main topic is a recent technological breakthrough.2. What is the significance of this breakthrough?Answer: The breakthrough is significant because it has the potential to revolutionize the industry and improve people's lives.3. How does the reporter describe the impact of this event? Answer: The reporter describes the impact as far-reaching and transformative.4. What are some of the challenges associated with this breakthrough?Answer: Some challenges include ethical considerations, regulatory hurdles, and potential job displacement.5. What is the public's reaction to this news?Answer: The public's reaction is mixed, with some expressing excitement and others expressing concern.Section B。
视听说3参考答案视听说3参考答案视听说3是英语教材中的一本教材,主要用于提高学生的听说能力。
下面是一些视听说3的参考答案,供大家参考。
第一单元:生活方式听力部分:1. A: What time do you usually get up?B: I usually get up at 7 o'clock in the morning.2. A: How often do you exercise?B: I exercise three times a week.3. A: What do you usually do on weekends?B: I usually hang out with my friends or watch movies.4. A: Do you eat breakfast every day?B: Yes, I never skip breakfast.5. A: How do you relax after work or school?B: I like to listen to music or read books to relax.口语部分:1. Describe your daily routine.In the morning, I usually wake up at 7 o'clock and have breakfast. Then I go to work or school. In the evening, I like to relax by watching TV or going for a walk. Before going to bed, I usually read a book.2. Talk about your favorite way to exercise.My favorite way to exercise is jogging. I like to go for a run in the park. It helps me stay fit and clears my mind. I usually jog for about 30 minutes three times a week.3. Discuss your weekend plans.This weekend, I plan to hang out with my friends. We are going to watch a movie and have dinner together. On Sunday, I want to go hiking with my family. It's a great way to enjoy nature and spend quality time together.第二单元:文化交流听力部分:1. A: Have you ever been to a foreign country?B: Yes, I have been to France. It was a great experience.2. A: What do you think is the most important festival in your country?B: I believe the Spring Festival is the most important festival in my country. It'sa time for family reunions and celebrations.3. A: What is your favorite type of music?B: I enjoy listening to pop music. It's catchy and upbeat.4. A: Do you think it's important to learn about different cultures?B: Yes, I think it's important to learn about different cultures. It helps us broaden our perspectives and promotes understanding and tolerance.5. A: Have you ever tried any traditional food from another country?B: Yes, I have tried sushi from Japan. It was delicious.口语部分:1. Talk about a cultural festival in your country.In my country, the Spring Festival is the most important festival. It usually falls in January or February. During this time, families gather together, exchange gifts, and have a big feast. We also set off fireworks to celebrate the new year. It's a time of joy and happiness.2. Discuss the importance of learning about different cultures.Learning about different cultures is crucial in today's globalized world. It helps us appreciate diversity and promotes mutual respect. By understanding different cultures, we can build bridges of communication and foster peace and harmony.3. Share your experience of trying traditional food from another country.When I visited Japan, I had the opportunity to try sushi. It was my first time trying raw fish, and I was a bit hesitant at first. However, I found it to be incredibly flavorful and fresh. It was a unique culinary experience that I will always cherish.以上是视听说3参考答案的一些内容,希望对大家的学习有所帮助。
B3U1L1A1 answerB Cbefore urban development took overthey look to humanstheir natural habitaton the edges of the rainforestsare essential to maintainingscript: While some visitors to Singapore expect a high-tech city, there are also some parts of the island that still reflect how it used to look before urban development took over.In one of the main Central Nature Reserves, monkeys still roam freely, living side by side with humans. The macaques have grown accustomed to being fed, so they look to humans as a source of food. But this in itself is problematic. As the monkeys depend more on humans for food, they venture further from their natural habitat, a phenomenon that has worried experts.There is just not enough space. Essentially, in much o f Southeast Asia we’ve seen a lot of habitat loss where rainforest has been destroyed and converted into human settlement. Singapore is a very urbanized city, and it’s taken a lot of space, so there is not much space left for long-tailed macaques.We really need to stop encroaching into nature reserves. We need to stop building the houses so nearby the reserves, which then causes the problem of the macaques coming into people’s houses and raiding them. These macaques are French species so they live on the edges of the rainforests.If humans keep building the houses so near the reserves, there will definitely be a constant human-macaque conflict issue.After all, the macaques are essential to maintaining the rainforest’s ecosystem. More should be done to protect them.V1 script: These creatures are known as statistics by most people. But we are treating them as individuals,trying to capture their personalities. We want to see them face to face, eye to eye, make them unavoidable.The series is now their mission in life, their calling and their passion. For the two photographers, it’s an endless odyssey across America to show the faces of creatures we may never see again. These creatures are in danger. They’re slipping away. But if people can see them, maybe we can make the effort to keep them with us here on earth.―Ok. Make here. Great! Great!‖The first Europeans on this continent had a common enemy to conquer. It was called nature. America seemed to be an endless expanse of hostile wildness. Bison wandered along the Potomac. Grizzly bears strolled [along] the beaches of California. Human beings did not even know it was possible for a species to go extinct. But we learned. Hundreds of creatures slipped into extinction. Even our national symbol was disappearing before our eyes.When you are driving across America, you understand why so many plants and animals are endangered. They’re losing their homes. We’re building a human world, and losing a wild one. Expert: ―It’s a sobering fact th at there is an extinction crisis. There have always been species going extinct time to time. But now, human activities push them to a hundred to a thousand times. Weare in the midst of a biological catastrophe. It is the greatest since the end of the age of dinosaurs, sixty-five million years ago. What I hope you’ll succeed in doing is to make endangered species a vivid presence in the lives of people; make it clear to them that every endangered species has a name, has a million-year history. There is a place in the world — bring us face to face with each one of those species; make us know that they are companions in the biosphere. They are not just something out there you look at once in a while. But they are a part of our existence. They’ re part of us.‖A2 script: During the whole year’s promotion, a series of activities will be held to promote public awareness in protecting biodiversity like summit forums and biodiversity knowledge competitions. Also, the government will conduct supervision to fight illegal hunting and other related conduct in nature reserves nationwide.Wan Bentai, general engineer at the Ministry of Environmental Protection says biodiversity is vital to human life. The Earth is colorful just because of biodiversity. If all the species were gone and there were only us humans left, humans wouldn’t be able to survive.Biodiversity not only refers to all the species, including animals, plants and insects but also the genes and our living environment. However, dozens of species are disappearing on our planet everyday. Currently, 34,000 plants and 5,200 animals are on the edge of extinction.Scientists say many species’ extinction is attributed to human activities. Many animals are endangered because of human activities like hunting and fishing. But many animalshave a close connection with humans, so we should treat them as friends. Besides, many plants make great contributions to human life, some of which are even more precious than gold.In recent years, the number of animal and plant species has declined sharply in China due to various reasons. We need policies which protect biodiversity. And we have to find programs which can encourage and provide incentives for people not to cut down the forest, nor to destroy the habitat of rare birds, nor fisheries. We have to do many things.V2 script: Scientist: ―In nature itself everything is connected. Every species is in some way dependent on others So you have this fabric of life. And to me an endangered species is like critical stitch in that fabric. The longer you study in any one area, the more you realize it if any one item becomes extinct, the whole fabric falls apart. Everything depends on everything else.‖Sixty years earlier, another scientist went in search of endangered species deep into the Louisianaswamps, trying to find one of the rarest birds in America. He found it and he filmed it. It was the firsttime anyone had ever filmed the ivory-billed woodpecker and the last.―We’re finally getting to photograph the ivory-billed woodpecker but it was not the way we had hoped.‖The birds’ habitat was decimated by development. In 1996 the ivory-billed woodpecker was finallydeclared extinct. ―It was rare and then it slipped away. The preserve is the best of all is left.‖Exp ert: ―Species do not die of old age. Species are killed off. And when a species dies, with it diesthis genetic history that can never be recreated. Scientists have even begun to think of how they might be able to reassemble a species, and the lost is perm anent.‖Plants get ignored. Almost two thirds of the species on the endangered list are plants. Theyarenot big and flashy like the giant panda or the rhino, but they are equally important in how life works.Without plants the animals wouldn’t be here. We wouldn’t be here.Human beings are the masters of this world now. We can take these animals and plants with us aswe travel into the future or we can say goodbye and send them into the night. But whether we realizeit or not, we depend utterly on other creatures for our very survival. They are a part of our existence.They are a part of us.Home Listening:1.flows2.unusual3.released4.expected5.risk6.supplies7.especially8.decade9.probably has the closest link between its resource and human livelihood than any other regionin the world.10.try to narrow down a framework agreement on global emission targets to be negotiated at theend of this yearB3U2A1 script: When it comes to intelligence, there has always been one fundamental question: Is intelligence a fu nction of nature? Is it simply encoded in a child’s genes? Or is it a function of nurture? Is it more about the environment that a child grows up in?On the one hand, if we take two people at random from the crowd, it is very likely that their degrees of intelligence will be completely different. However, if we take two identical twins, chances are that they will be as intelligent as each other. Therefore, a conclusion can be drawn that intelligence is to some extent something we are born with. On the other hand, though, if we put identical twins in different environments, we would find differences in their intelligence several years later, which indicates that environment does play a crucial role in people’s intelligence.Recently, data has clearly indicated that nurture is indeed more than 50% of the equation. That is good news for educators, but even better news for society as a whole.Fortunately, President Obama has come out in strong support of early childhood education, particularly for those children most at risk of school failure. Investing in quality pre-school opportunities clearly helps give children from poverty-stricken areas the chance at a stronger start in school and in life.If we are serious about helping our children succeed in school, if we are truly interested in ―Leaving No Child Behind,‖ we will take a hard look at this compelling data and begin investing greater sums at the early childhood level.V1 script: Einstein’s destiny as a great physicist was not obvious. As a c hild, his passion was music, not physics.―I often think in music. I live my daydreams in music. If I were not a physicist, I would probably be a musician.‖But Einstein’s life changed when he was given a book on geometry. The universe could beta med through numbers. His life’s work would be to control the music of the universe.During his life, Einstein changed our concept of space and time forever. He harnessed energy, mass and the speed of light in the most famous equation all time — E equals MC squared. What made Einstein’s brain so exceptional? Dr. Jim Al-Khalili, like Einstein, is a physicist and is obsessed by the work of his hero. Brain specialist Mark Lythgoe hunts for secrets of creativity inside the human mind.―My name is Dr. Ji m Al-Khalili I believe Einstein’s genius came from his imagination, and no man or no machine can measure that. Am I right?‖―My name is Dr. Mark Lythgoe and I believe that Einstein’s genius comes from nerve cells, which can be analyzed. We can find out what made Einstein a genius. Am I right?‖So which view is correct? To solve the riddle of Einstein’s genius, Mark and Jim would have to journey to America to hunt down and examine Einstein’s disembodied brain. Nature or nurture?Biology or training? Are geniuses born or are they made? Neurophysiologist Dr. Mark Lythgoe is a keen climber and finds parallels between his hobby and his profession.―Now, there are two scenarios for how the brain works. The first scenario is the brain is like a muscle. Now I’ve trained to develop the stamina in my muscle, hopefully then I can hold on to this hole for a period of time. The second is that the brain is like a skeleton and it doesn’t matter how much I’ve trained, I’m never, ever going to be able to reach that hol e right up there.―Now, in Einstein’s day they believed that the brain was like a skeleton that had natural limits, but that view is changing today. Instead, it is now understood that more and more parts of the brain behave like a muscle. They can expand with use. Then, if all of our brains are like muscles, could it be that we all have the ability to become Einstein?‖A2 script: Albert Einstein was a German-born physicist, although most people probably know him as the most intelligent person who ever lived. His name has become part of many languages when we want to say someone is a genius, as in the phrase, ―She’s a real Einstein‖. He must have been pretty brainy to discover the Theory of Relativity and the equation E=MC2.In 1999, Time Magazine named Einstein as the Person of the Century. No one could have guessed this would happen when he was in school. He was extremely interested in science but hated the system of learning things by rote memory. He said it destroyed learning and creativity. He had already done many experiments but failed the entrance exams to a technical college. He didn’t let this setback stop him. When he was 16, he performed his famous experiment of imagining traveling alongside a beam of light. He eventually graduated from university, in 1900, with a degree in physics.Twelve years later he was a university professor and in 1921, he won the Nobel Prize for Physics. He went on to publish over 300 scientific papers. Einstein is the only scientist to become a cult figure, a household name and part of everyday culture. He once joked that when people stopped him in the street, he always replied, ―Pardon me, sorry! Always I am mistaken for Professor Einstein.‖ Today, he is seen as the typical mad, absentminded professor, who just happened to change our world.V2 script: So Einstein’s brain has given up some of its secrets to Mark and Jim. In the battle of biologyversus ideas, Jim and Mark have each scored points. Seemingly, Einstein was born with overlaps inhis brain. These overlaps may have meant maths and spatial thinking were more intuitive to him. Thinking like a child let him see the world in a unique way. And his unique, perhaps autistic, level of concentration, forced his brain to expand like a muscle. Extra glial cells were needed to cope withthe extra demand, possibly helping make the maths area in the brain more than 15% wider than normal. All these effects united to give Einstein a mind unlike any other, perhaps the greatest mind in history. In the future, could we preserve a genius like Einstein in something better than the jar? Imagine a brave new world, where a genius’ brain could be copied onto silicon using microscopic robots called nanobots. This is the vision of the futurologist Ray Kurzweil.―I think by the 2020s or t he late 2020s, we will have completely reverse engineered the brain and understand how all the different regions work. It’ll take us longer to be able to scan the entire brain and get capture of every detail of someone’s personality. The blood vessels of t he brain go everywhere, and so if we send billions of nanobots through the capillaries of the brain, they can scaneverything in the brain of a specific person at very high resolution. Then you could create a machine,a non-biological entity, that would si mulate a specific person’s brain and that simulation will act just like that person, and if you then talk to that simulation, you’d be convinced that it was that person.‖―I am little worried about whether I’m talking to the real Ray or he’s at home having a cup of tea.‖―Well, I worry about that too. Once we understand the basic principles of operation of how the brain works, we can take a brain-like system and expose it to a complicated problem and the systemwill learn on its own. It can actually do it thousands maybe eventually millions of times faster than areal human brain and actually develop skills that are far greater than a human being is able to.‖So a future Einstein could be put on a computer, literally a ghost in the machine.―Do you believe t hat, you know, just by looking at that, genius is — or genius is something else for you?It’s a key moment. Has Mark won Jim round?―Day by day, I’ve been changing my views. I’ve been —I started off feeling that Einstein’sideas have gone forever. What he thought of, what he’s capable of imagining were something of the past. I’m not so sure now. I feel somehow there are still, maybe, possibly, some secrets locked inside in this jar.‖Home Listening:1.genius2.scattered3.conducted4.permission5.convinced6.decades7.accomplished8.He would much rather build houses of cards, which he was really good at, or do just aboutanything else.9.Whether it was while out sailing or at a formal dinner at the White House, Einstein wentwithout socks everywhere.B3U3A1 script: To imagine life in the future, you have to know what might be possible. You also need a lot of imagination. There have been many exhibits, such as those at World’s Fairs and theme parks, showing how future homes might look and work, sponsored by builders, developers or technology companies. Science fiction is another way to predict the future. It’s a kind of writing that blends real science with fantasy. Over the years, science fiction writers, artists and engineers have had many ideas about what life would be li ke in the future. Here’s a look at what some of the leading scientists are working on today to bring into your homes tomorrow.On the outside a home might look like any other. But inside, it can be high-tech all the way! Computer scientists have found n ew ways to use technology to make people’s lives easier. For instance, sensors can show if someone is in your home and where they are at all times. You can check in from any computer — anywhere. The stuff of cutting-edge scientific research today is tomorr ow’s household technology, and high-tech consumer products could be available in your future home!V1 script: Other than to enjoy your personal rocket, in the future you may never wanna leave the house.Your home will be self-sufficient in ways you never dreamed of.To begin with, you won’t have to go shopping. Your house will be able to make whatever you want with a revolutionary new appliance called the Digital Fabricator, or Fabber. ―Fabber is a 3D printer, [a] machine that can deposit a variety of materials in order to make 3-dimensional objects.‖Hod Lipson’s fab-at-home Fabber will make 3D objects right on your desktop. Just as your computer printer creates 2-dimensional documents and photos, the Fabber takes this process one step further, turning digital data into solid physical objects. Instead of ink, it uses whatever materialthe desired object is made of.― We start off with a computerized model of what the target object should look like, and then these different materials are extruded from the syringe layer by layer in order to gradually create the3-dimensional objects.‖Right now, Lipson’s home version of the Fabber only works in simple plastics and metals. Theresults are still crude and take a long time to complete.―Currently, the fab-at-home printer can fabricate something like a fork in a couple of hours. I think eventually we’ll be able to use these machines to print things in a matter of minutes.‖As the technology improves, there is theoretically no limit to what the Fabber can produce.―Recently we’ve been able to use a Fabber to make things like a functional 3-dimensionalbattery, circuitry, toys, parts of robots, and even food.‖Once all the kinks in this computerized cooking are worked out, your Fabber may become an e ssential kitchen appliance. And expectations for the device don’t stop there. ―This is a very universal type of technology that’s applicable to a wide variety of things, and it is conceivable that you could print even large things such as cars or houses.‖ While printing your own house seems like a stretch, your Fabber could download and print the latest must-haves for your home and eliminate the need for replacement parts. You’ll be your own factory and builder. And with the Fabber, you’ll never again have to make that last-minute run to the home-improvement store.―You could imagine in the future where you shop online for items, and once you find what you want, you’ll essentially purchase the blueprint and print the device you’ve purchased on your own d esk at home.‖Futuristic homes, humanoid robots, superhuman powers all represent science fiction fantasies come to life.A2 script: What if we could wear bodysuits to give us super strength? Own an identical robot twin to work for us? What if we could travel through time? Technology is pushing from every direction, getting faster with each passing second. Prepare yourself! The future is closer than you think.A robot conducting a symphony orchestra! Amazing as that is, it’s just one way reality is outpacing science fiction. Every day robots become even more sophisticated, taking on additional human traits. Until now, robots have mostly gotten the toughest jobs. They work at the assembly line and defuse or even detonate explosive devices.The traditional tasks for a robot have always been the 3-D’s: dull, dirty, dangerous. But as technology improves and as researchers are work towards developing these intelligent humanoids, we are going to see our homes and offices occupied by robots. It makes sense that if you are going to build a general-purpose robot that can perform any task that a human can do, you’d like to give it a human shape. It can walk gracefully. His creators study motion-capture video of both humans and animals. I believe that humanoid technologies will improve our lives in the 21st century.V2 script: ―One of the main goals of claytronics is to improve human-to-human communication evenwhen two people aren’t in the same room. So you can imagine having a call in the future where you pick up your phone and you dial someone, and instead of just hearing their voice, you see them sitting across from you. Of course, they are made out of claytronics.They are still where they were originally, and that way you can have a very real experience of being in the same place with somebody —it’s voice, picture and touch.‖Your future home may be self-sufficient, creating its own furniture, your dinner, evenyour dinner partner at the press of a button. But what if being a homebody gets a little boring? The home of tomorrow even has that covered, allowing you to travel around the world without packing a bag.―Telexistence is a technology that enables you to go everywhere, so you can go [to] Mexico, you can go [to] paris, or even the Amazon, and you have the feeling that you are over there without going there.‖Professor Susumu Tachi is the inventor of a cutting edge multimedia device called the Twister.―Twister is a future TV —television, future computer display, and future Play Station.‖The Twister will give you a 3-dimensional live motion picture experience. A cylinder with 30separate display units rotates around the viewer, as fast as 1.6 revolutions per second.As the units show slightly different perspectives of the same image, the sensation becomes both immersive and 3-dimensional. Science calls this the binocular parallax effect. You will experience it as the ultimate virtual reality.―If you have the 360 degree scenery, and also it’s 3-dimensional, it’s top stuff.‖When connected to live video, the Twister will give you the experience of going anywhere in the world and visiting anyone.―So you have the feeling that you are meeting other people, just like you are meeting faceto- face directly.‖The ultimate goal of virtual reality is to create images and spaces so life-like, so dimensional, that it’s impossible to distinguish them from the real world. Twister will make this dream come true turning tomorrow’s home into a global environment.No single planet has captured our imagination more than Mars. And as our actual knowledge of earth’s nearest cousin increases, so do the odds that one day we might need to live there. It’s because of what’s happening here on earth that traveling to the red planet is considered so important.Home Listening:1.modelsplicated3.average4.damage5.incredible6.inventor7.detective8.amazing9.Yet it took an artist to put them together in a new way – slowly, real life caught up with thecomics10.As ―Dick Tracy‖ exemplified, pieces of what was in t he present can come together later inthe future.。