当前位置：文档之家 › LDE225_COA_16487_MedChemExpress

LDE225_COA_16487_MedChemExpress

  • 格式：pdf
  • 大小：91.86 KB
  • 文档页数：1

Inhibitors, Agonists, Screening Librarieswww.MedChemExpress.comCertificate of Analysis

PHYSICAL AND CHEMICAL PROPERTIES Molecular Formula:C26H26F3N3O3Molecular Weight:485.50Storage:Powder-20°C3 years4°C2 yearsIn solvent-80°C6 months-20°C1 monthChemical Structure:

ANALYTICAL DATA Appearance:Pale purple to purple (Solid)1 H NMR Spectrum:Consistent with structureLCMS:Consistent with structurePurity (LCMS):99.56%Conclusion:The product has been tested and complies with the given specifications.Product Name:LDE225Cat. No.:HY-16582ACAS No.:956697-53-3Batch No.:16487Chemical Name:[1,1'-Biphenyl]-3-carboxamide, N-[6-[(2R,6S)-2,6-dimethyl-4-morpholinyl]-3-pyridinyl]-2-methyl-4'-(trifluoromethoxy)-, rel-

Caution: Product has not been fully validated for medical applications. For research use only.Tel: 609-228-6898 Fax: 609-228-5909 E-mail: tech@MedChemExpress.comAddress: 1 Deer Park Dr, Suite Q, Monmouth Junction, NJ 08852, USAwww.MedChemExpress.com

合集下载

SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS_COA_27410_MedChemExpress

SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS_COA_27410_MedChemExpress

Inhibitors, Agonists, Screening Certificate of Analysis

PHYSICAL AND CHEMICAL PROPERTIES Molecular Formula:N/AMolecular Weight:3443.87Storage:Protect from lightPowder-80°C2 years-20°C1 yearIn solvent-80°C6 months-20°C1 monthChemical Structure:

ANALYTICAL DATA Appearance:White to off-white (Solid)LCMS:Consistent with structureHPLC:Consistent with structurePurity (HPLC):95.96%Conclusion:The product has been tested and complies with the given specifications.Product Name:SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPSCat. No.:HY-P1227Batch No.:27410

Caution: Product has not been fully validated for medical applications. For research use only.Tel: 609-228-6898 Fax: 609-228-5909 E-mail: tech@Address: 1 Deer Park Dr, Suite Q, Monmouth Junction, NJ 08852, USA

Lemborexant_LCMS_16649_MedChemExpress

Lemborexant_LCMS_16649_MedChemExpress

=====================================================================

Acq. Operator : Li Shan(LCMS-02) Seq. Line : 26Acq. Instrument : HY-LCMS-02 Location : P1-C-03

Injection Date : 6/19/2015 11:29:40 AM Inj : 1 Inj Volume : 3.000 µlAcq. Method : D:\AGLIENT 1260\DATA\20150619\20150619 2015-06-19 09-39-29\100-1000MS+3MIN- 1.5_(0.02%FA).MLast changed : 6/19/2015 9:39:29 AM by Li Shan(LCMS-02)Analysis Method : D:\AGLIENT 1260\METHOD\50-1000MS+3MIN_1.5(0.02%FA)(50-100A).MLast changed : 6/19/2015 12:16:55 PM by Li Shan(LCMS-02) (modified after loading)Method Info : Postive,MS:50-1000,Column ID:A-RP-132,40℃ Catalog No : HY-16725 Batch#16649 A-RP-132 Additional Info : Peak(s) manually integrated

min0.511.522.53mAU

020040060080010001200 DAD1 B, Sig=214,4 Ref=off (D:\AGLIENT...60\DATA\20150619\20150619 2015-06-19 09-39-29\BIZ2015-619-DJL8.D)

Iohexol_LCMS_17021_MedChemExpress

Iohexol_LCMS_17021_MedChemExpress

=====================================================================

Acq. Operator : Li Shan(LCMS-02) Seq. Line : 27Acq. Instrument : HY-LCMS-02 Location : P1-D-03

Injection Date : 7/10/2015 10:36:24 AM Inj : 1 Inj Volume : 3.000 µlAcq. Method : D:\AGLIENT 1260\DATA\20150710\20150710 2015-07-10 08-35-53\100-1000MS+3MIN- 1.5_(0.02%FA).MLast changed : 7/10/2015 8:35:54 AM by Li Shan(LCMS-02)Analysis Method : D:\AGLIENT 1260\DATA\20150708\20150708 2015-07-08 10-25-03\100-1000MS+3MIN- 1.5_(0.02%FA).M (Sequence Method)Last changed : 7/10/2015 12:33:45 PM by Li Shan(LCMS-02) (modified after loading)Method Info : Postive,MS:100-1000,Column ID:A-RP-132,40℃ Catalog No : HY-B0594 Batch#17021 A-RP-134 Additional Info : Peak(s) manually integrated

min0.511.522.53mAU

020406080100120140 DAD1 C, Sig=254,4 Ref=off (D:\AGLIENT...60\DATA\20150710\20150710 2015-07-10 08-35-53\BIZ2015-710-DJL1.D) 0.465

Linsitinib_COA_23891_MedChemExpress

Linsitinib_COA_23891_MedChemExpress

Inhibitors, Agonists, Screening Certificate of Analysis

PHYSICAL AND CHEMICAL PROPERTIES Molecular Formula:C26H23N5OMolecular Weight:421.49Storage:Powder-20°C3 years4°C2 yearsIn solvent-80°C6 months-20°C1 monthChemical Structure:

ANALYTICAL DATA Appearance:White to yellow (Solid)1 H NMR Spectrum:Consistent with structureLCMS:Consistent with structurePurity (LCMS):98.58%Conclusion:The product has been tested and complies with the given specifications.Product Name:LinsitinibCat. No.:HY-10191CAS No.:867160-71-2Batch No.:23891Chemical Name:Cyclobutanol, 3-[8-amino-1-(2-phenyl-7-quinolinyl)imidazo[1,5-a]pyrazin-3-yl]-1-methyl-, cis-

Caution: Product has not been fully validated for medical applications. For research use only.Tel: 609-228-6898 Fax: 609-228-5909 E-mail: tech@Address: 1 Deer Park Dr, Suite Q, Monmouth Junction, NJ 08852,