新编大学英语视听说教程第三册答案

新编大学英语视听说教程3答案1. A: What did you think of the movie we watched last night?B: I found it quite captivating. The storyline was unique and the acting was superb.2. A: Did you attend the lecture on climate change?B: Yes, I did. The speaker provided a lot of insightful information and raised awareness about the urgency of addressing this issue.3. A: Why did you choose to study psychology?B: I have always been fascinated by the human mind and behavior. Psychology allows me to understand and help people better.4. A: Have you read the latest novel by your favorite author?B: Not yet. I'm currently in the middle of another book, but I'm looking forward to starting it soon.5. A: How was your interview for the internship?B: It went well, I believe. I was able to showcase my skills and experiences effectively and I had a positive rapport with the interviewer.6. A: What do you think are the key factors for successful teamwork?B: I think effective communication, mutual respect, and a shared goal are crucial for successful teamwork.7. A: Did you enjoy the concert last night?B: Absolutely! The band performed exceptionally well and the atmosphere was electric.8. A: How do you manage your time effectively as a student?B: I make use of a planner and prioritize my tasks. I also try to eliminate distractions and set realistic goals for myself.9. A: What are your thoughts on the use of technology in education? B: I believe that technology enhances the learning experienceand provides opportunities for personalized and interactive learning.10. A: Have you ever traveled to any foreign countries?B: Yes, I have. I have been fortunate to visit several countries, and each experience has been eye-opening and enriching.。

Unit 1PART 1Listening 11. FFTTFT2.outside worldat homewave hellobowlook straight into the eyesopenlylook at my feetshy and silentListening II1.1.sensitive independent2.good friend3.life people4.learning being aware2.BCADBListening III1.1.ice-skating2.chemistry3.outgoing, bright, funny4.self-centered5.blond medium height6.runner-up2. TFTFFLstening IV1.1. Four2.Colleagues3.Teacher./Teaching4.Susan5. To go on holiday2.1.Paul:DEJ2. Susan: B F3. Maria: C H4. Peter: AGIPART 21.1.Mike C2Sam E3.Ted D4.Simon A5.Lilly B2.avoid confrontationgenerally likeablehide those traitsaffectionate kind nature stubbornnessworst reputationrevengeful and destructive entertainingtough and determinedintuition and protective nature perfectionistsdraw attentionPART 31.1. The lunar calendar2.Two trines3.Four trines2. who is very good with money who is easily angereddisplay the utmost amount of energy longest life and good fortunewith quick witgreat common senseinspires leadership in others seductive and charmingdeep-thinking and very talented interesting and bravePART 4Listening 1upsetsensiblelecturecalmstrengthlandedswearingperfectlywildlybeeListening II1.BDAACCDCListening III1.1 PELedro C2 Mr. Miller C3. Mr. Smith E4 Jake A5 Mrs. Duke F2.1.favorite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoop Listening IV1.FTFFT2.understand the Scots' English the friendliest peoplemuch nicer thanEngish courtesyno views on the matterUnit 2Listening I1. BABD D(最后一个答案存在疑问，应选C，请读者参考听力录音确认)2. FTTFTListening II1. AABCD2. TFTTFFListening III1.1) stayed around2)mouse catcher3)rats and mice4)got a paw5)weak and thin6)make a wooden paw7)fastened it8)grow sleek and fat9)managed10) peered out cautiously11)seized it with12) 18 miceListening IV1. BDAAC2. FTTTFTFFPART 21.1 C2 E3 D4 B5 A2. in your handused to belong topracticing withtalked to each otherwhy notask forfind a waymanage tohis own loveso foolishly jealousall three of thempeacePART 31. DCABA2.InvadesheltersupplypeacewithdrawflaghangedremembersecretsharequeenPART 4Listening 11. BCBADA2. FFTTFListening II1. 1. CDJ2.AEGH3.BFI2. ABDCBDListening IIITFFFTFTTListening IVassociatedrailroadmerchantdictionariesgrasslandsbringactionOne hundred days after his offer was made, the first herds arrived from the South.Soon there were at least 5000 cowboys bringing cattle up to Kansas from Texas.These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3Part 1Listening 11. BCDA2. FTFTFTListening II1. BDAD2. 30smale190long wavyheavily builtlight red sweaterbeardListening III1. BCAC2.lovetogethermotherhouseschoolfriendsfathermonthbeachcallListening IV1. Stories music next door in love with secretary fights3×4 √2. Celia: 1 √2 √3×4√Sara 1×2 √　2×3×4√Jack 1 √　4×Tom 1√2 √ 3√PART 211D 2C 3 B 4 E 5 A3. TFFTTTTTFFPART 31.a central bodytransport visionaccessa race trackslightly slowerhuge success2. car movementcyclingwalkingstrategiesquality of lifevisit the cityinvestmentdesignenvironmentsubtle designfocusPART 4Listening 11．FTFT2．South Americapet foodenough proteindevelopmuch moreAfricapositionnatural resourcesgone downsteadycontinued to risegetting richer and richerListening II1.the first few secondsso thinbeings from another planetfocused onlooked directly atAll arounduntil nowdespair grief and disguststarted cryingwho was sleeping peacefully6×7×8√2. 1√2 √3×4 √5√Listening IIIComplainedworkchestshockedcold-bloodedinvestigationdealingHe had mentioned his concern twice to the local officialWhenever this topic arose he always expressed strong views about drugs.ted to the murder.But it’s still early to say this is relaListening IVpovertycrimedriftbetter workresentmentattractiveeducation servicesa more positive attitudeUnit 4Part 1Listening I×,8√1 1×,2√,3×,4√,5√,6√,721)weaknesses,2) similar abilities and interest, interest you, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combinationListening II1.DDAB2.1）import from abroad 2）sales manager 3）salary 4）sales commission5) travel in 6)experience 7)university 8)on a teamListening III11)Choose their careers, 2) avoid certain careers3) different professions, 4) impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance 2 TFTFTListening IV1.C A C B D2.1)occupation cool2)catch provide fulfilling3)media coming after you make your own work schedule4)have my pick of jobsPart 2×K√L√1. A√B√Ｃ×D√Ｅ×F√G×H√I√Ｊ2 1) computer engineering, 2) computer programmer, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical research, 9) management, 10) 3600Part 31.A√Ｂ×C√D√Ｅ×F√Ｇ×H√2.1)tremendous element of care, what kinds of contributions2)where you’re from3)professional learning, colleagues, peers4)what makes their students tick5)relaxed, care about them, passionate, developPart 4Listening I1)100 million2)35, 403)seven, eight4)office workers, many professionals5)8:00, 4:006)eight-hour shifts7)Monday, Thursday, Saturdays, Sundays8) choose their own working hours, freedom of choice, happy withListening II1.ADCADListening IIICBDCAListening IV1. CABDB2.1) ADF2)BF3)ACEUnit 5:Part 1：Listening 1:1.1.plays, real people real life, emotional, problem, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kind2. F F T T T TListening II:1. 1 C 2 A 3 D2.1.be understood easily2.necessary desirable3.splendid4.prevents, from achieving5.anxiety, effectListening III:1.1.T2. F3. F4. F5.T6.T21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IV:11. C2. C3. A4. B21.eggs, toast2.realistic, far better than, forgetting3.determined, personality culture4.recite aloudPart 2：1．1-B 2-A 3-C 4-E 5-D 6-F2.1.over long distances2.look into it3.five times4.individual group5.sex-specific males females strangers6.great apes7.teach own kind8.raised held look bigger9.round tail-wagging10.feeding every directionPart 31.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.Johned joined6.Siji…Siji Delaney Sinjin Delaney7.Awful lawful8.Spigot spiritPart 4Listening 11.Economic2.religions3.exist4.biologically5.40,0006.cave7.Written8.humans were probably speaking thousands of years before that9.Even while we are reading or just thinking, we are in a sense“talking”nguage is so much a part of human existence that we will betalking as long as we inhabit the Earth.Listening II1. D A B B A2.1.Permission apply for2.application form website3.regular mail faxcredit cards4.traveler’s checksListening III1A×B√ C √D×E√21)Other native languages2)two3)more4)of their choice5)Spanish6)Indians7)English German FrenchListening IV1.1.learner teacher curriculum2.Curiosity expectations goals2.T F T F TUnit 6PART 1Listening I1. BCDB2. TFFFTFLstening II1.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACALisening III1.CABD2.1.crowding war water grass2.what is happening keep the number of horses low3.target practice where the horses were found4.gotten rid of stayListening IV1. FTFTFTFF2. 1×2×3×4√　5× 6 √PART 21.DABCCA2.1.farm animals hold feed2.small pets toys3.bury toss them out4. real shame5.dangerous destructive bring diseases6.have a point7.humanely limit8.time money warm place9.isolated company10.storm of debatePART 31.ADDBACAB2.1. female collectively2. not a moment3.infinite care4.picks up keft to right5.stuck smarter6.salt water lake dock7.self-aware non-human intelligence belong in captivityPART 4Listening 11.1√ 2×3×4√ 5√ 6√ 7 √ 82.ACCADLstening II1. CBDDA2. 1×2√ 3×4×5√ 6×7√ 8×Lstening III1CADBB2.1.family holiday2.7-foot 18 stones3.stroking adjusting his clothing4.fractured skull black eye broken arm5.lose his love6.cat7.get-well cards presentsLisrening IV1.1）a.whales and dolphinsb.birdsc. tigers2）a. meat oilb.handbags shoesc.furd.ivory2.TFTT。

~~~Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly B Exercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm 5) strength 6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C8. B Section III1) secretary 2) hard-working 3) efficient 4) private 5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening III Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw 7) fastened it 8) grow sleek and fat 9) managed 10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.T Practice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. DPractice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. T Practice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. AExercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. T Section III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7. F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction 4) species 5) oxygen 6) economic 7) conservation 8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house 5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa￥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11.plays/ real people/ real life/ emotional problem/ loyalty/ popular2.public speech / make themselves taller/ political one-sided3.soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. BExercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11.learner/ teacher/ curriculum2.aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by 10. sense 11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. AExercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debatePart TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particularExercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat8. clean9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.DExercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. AExercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July 14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages EExercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking 8. convenient 9. restaurants 10. bathrooms Exercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4.vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7) A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. DSection III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5，7，1，4，6，3，2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short8. elbows9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.TPart Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior 14. fluently15. read 16. exceptional 17. preparation 18. fully Section II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W 11. W 12. W 13. C 14. W 15. W 16. C 17. W 18.W Exercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11.restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slowerExercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the strings5. manages the bowExercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. T Exercise 2Bruce Springsteen: communicative, direct, exciting, simpler Sting: naturalPeter Gabriel：musicalBranford Marsalis: brilliant, humorousYoussou N’Dour：not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31.terrible rubbish / deafening/ stand2.slow-paced/ peaceful3.concentration on them4.dreamt of / afford5. dwell on the past / more freedom5.keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired 10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21.N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11.work, family, health, friends, spirit2.work / bounce back / marked/ damagedExercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days 8. give up 9. stop trying 10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings 16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. ASection II 1. C 2. B 3. D 4.A 5. BSection III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black 11. white 12. shaking 13. wet 14. sweet 15. delicious16. angel 17. grave 18. nights 19. days 20. taste。

新编大学英语视听说book3Unit4听力答案及文本1Unit 4Part OneListening IFor many of you this will be your last year at university and now is the time for you to begin thinking seriously about your future careers. In order to give you as much help as possible, I have quoted a list of questions that you ought to ask yourself.First, "Have I got a clear knowledge of my abilities as well as my interests?" Be honest about your weaknesses as well as your strengths. Take a really good look at yourself and give real thought to the kind of person you are, and what kind of person you want to be.Second, "Do I know the kinds of occupations in which people like myself tend to find success and satisfaction?" Talk to people who have similar abilities and interests and who are already in the careers that interest you. You can gain some idea of what they consider to be important and challenging in those careers. Watch these people at work.Third, "Have I weighed carefully the immediate advantages against the long-term prospects offered by the jobs I am considering?" Will the occupation you select give you satisfaction in the years to come? Realize now the importance of education in all fields, technical and professional. Remember that chances of promotion are usually given to educated persons—other things being equal.Fourth, "Have I talked with my parents, my teachers and my headmaster?" Remember they have a lot of experience that you can benefit from. They can help you think about the jobs. Theycan stimulate you to give careful thought to what you really want to do, and offer useful suggestions about how you might take full advantage of your personal qualities and qualifications.Last, "How do I regard my job? Is it just a means of getting money to do the things that I want to do? Is the work important to my future happiness? Is it a combination of both?"The above questions and their answers should give you some better ideas about how you should start planning your career. Your life-long job cannot be approached in any kind of haphazard fashion. It must be considered carefully, examined from every angle, and talked over with those who know you and those who can help you in any way.Exercise 12、4、5、6、8Exercise 21. weaknesses2. similar abilities and interests / interest you/ important and challenging3. education/ promotion/ educated persons4. parents/ teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II(Here's a dialog between a woman whose job is to help people find jobs and a man looking for a job.)Woman: Look. Here's a job that might interest you.Man: What is it? Are you sure? The last job interview you sent me off to was a disaster.Woman: Well, look. It says they want a sales manager, and it looks like it's a big international company. That'd be good. Youmight get to travel.Man: What kind of company is it, though?Woman: Um, let's see. Yes, it's a textile company that seems to import from abroad. They say the salary is really good. They operate a system of paying you a basic salary and then offering you a sales commission on top of that. They say it is high. And oh, look! They give you a car to travel round in. That's not bad, is it?Man: Um, do they say anything about experience?Woman: Um, let's see. No, they want someone young with ambition and enthusiasm. Oh yes, they want graduates, so that's OK. You've been to university. Now what else? Let's see.Man: There must be some catch.Woman: No, the only thing is you have to travel, but then that's what the company car's for. Oh, and you have to be able to get on well with other people because it says you have to be good on a team.Man: Um, perhaps I'll have a closer look at that one.Exercise 11. D2. D3. A4. BExercise 21. import from abroad2. sales manager3. salary4. sales commission5. travel in6. experience7. university8. on a teamListening IIIInterviewer: Some people feel that their jobs are misunderstood by others. Is that very common?Sociologist: Oh, absolutely. Most jobs or professions have an image or stereotype attached to them, and some of these are not realistic. The serious point is that young people choose their careers based on these false images, and they may even avoid certain careers which have a negative image. This can cause problems for the economy.Interviewer: Is there evidence of this problem?Sociologist: Yes, there was a recent survey of children's attitudes to different professions.Interviewer: How was this done? Children don't know much about jobs and professions.Sociologist: True. What the investigators wanted to get was children's impressions and prejudices. They gave the children twelve pairs of statements, one of the pair positive, and the other negative. Children were asked to say which of the statements was "most true" for each profession.Interviewer: For example?Sociologist: Well, for example, "Such and such a person is likely to be boring or interesting company."Interviewer: I see. What professions did they ask about?Sociologist: The list is long, but it included lawyers, economists, accountants, sales representatives, scientists and engineers.Interviewer: And the results?Sociologist: Well, they are striking, especially for engineerswho came out much worse than one might expect. About 90 percent of the children thought that engineering was a "dirty job", of "low status", and the engineer was more likely to take orders than to give them. The only other person they thought more likely to lose his job was the sales representative. But, there were good points too. Engineering was seen to be "interesting, well-paid work".Interviewer: Hmm, not a rosy picture.Sociologist: No, but it got better when children were asked what they thought of the engineer as a person. Most of them chose positive comments, but most thought the engineer was likely to be badly dressed.Interviewer: What about other professions? What were the most popular?Sociologist: Oh, the lawyers by far. Next came accountants and scientists as well as economists. The engineers and sales representatives were the least popular.Interviewer: Sounds like a sign of the times.Sociologist: Yes, but I think the most serious implication was the children's apparent ignorance of the importance of the engineer's role in society.Exercise 11. choose their careers2. avoid certain careers3.different professions4. impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. F3. T4. F5. TListening IVMegan: Tim, if you could pick any occupation in the world, what do you think would be a cool one?Tim: Well, truth be told, i think it would be pretty awesome to be a commercial fisherman. Megan: Fisherman! Why would you want to be a fisherman?Tim: Believe it or not, i’m really fascinated by the ocean. I like spending time in the ocean and I think if you go out on those boats and get away from the land, you really get in touch with the sea.Megan: Is it dangerous, though?Tim: Oh, it can be dangerous, for sure. You can get caught in storms. It can be rough sometimes.Megan: Do you get paid a lot of money?Tim: Not so much, but that is not necessarily vital. You know, you can work with nature. You can catch healthful food, provide for yourself, and I think that’s really fulfilling. How about you , Megan? What do you think would be a cool job?Megan: I think I would like to be a writer.Tim: Why is t hat? Lots of writers don’t succeed in making much of a living.Megan:Well, being a movie star would be exciting too, or a rock star, but the fame is overwhelming—too many peoplealways want to talk to you or want your autograph. I think as a writer, you are doing something you love without all that pressure or the media coming after you, and you can sort of make your own workk schedule and do it where you like. You can write in the countryside in a cabin, or you can write in the city wherever you please. So, I think it is a very flexible, rewarding job.Tim: Yeah, you’ve got to have the aptitude for it, though. Do you think you have what it takes?Megan: No, not yet. I’m a terrible writer. But anyway, if I could have my pick of jobs, I’d like to be a writer.Exercise 11. C2. A3. C4. B5. DExercise 21. occupation, cool2. catch, provide, fulfilling3. media coming after you, making your own work schedule4. have my pick of jobsPart 4Further ListeningListening IThere are at least 100 million workers in the Unites States. Most of them are on the job 35 to 40 hours a week. Their typical day includes seven to eight hours of work. Usually, they have a 15-minute coffee break in the morning and in the afternoon. But work schedules vary from job to job.White-collar workers—office workers and manyprofessionals—usually have "nine to five" jobs. They begin at 9:00 a.m. and finish at 5:00 p.m. Monday through Friday. "Blue-collar" workers—mechanics, electricians, and laborers—often work from 8:00 a.m. to 4:00 p.m. In many factories, blue-collar workers come to work in eight-hour shifts. Typically, these shifts start at 8:00 a.m., 4:00 p.m., and midnight. Finally, sales people and managers in retail stores work on Monday and Thursday nights, when the stores are open. Many retail workers also work on Saturdays, and some work on Sundays.These are the normal schedules for most American workers. However, many businesses now use a new system called "flex-time scheduling". Under this system, the employees choose their own working hours. Some people work from 8:00 to 4:00 five days a week. Some work from 9:00 to 5:00. Other people work 10 or 12 hours a day four days a week. Employees and managers are both happy with the system. The employees like the freedom of choice, so they work hard. The managers, of course, like the hard-working employees.What, then, is a typical work schedule? It depends on the job—and on the workers.Exercise:1. 100 million2. 35 to 403. 7 to 84. office workers, many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday ,Thursday, Saturdays ,Sundays8.choose their own working hours, freedom of choice , happy withListening IIMan: How long have you worked for AM-ADMEL, Gill?Woman: Only for a year. It's May now, isn't it? Yes, I joined last August in fact.Man: August in 1996.Woman: Yes.Man: What did you do before that?Woman: I used to work for a travel agency in London.Man: It was interesting, wasn't it?Woman: Not really. It was just secretarial work, rather like this job. And it wasn't too well-paid. But I took a secretarial course when I left school and I couldn't think what else to do.Man: So you went straight from school into a secretarial course, didn't you?Woman: Well, not quite. I left school when I was 16, in 1989, I think it was. And then I went to work in a hotel in Austria for a year, to learn some German.Man: Austria? Why Austria?Woman: I don't know really. Well, we used to go there on holiday quite often when we were younger, and, well, I like Austria actually. Anyway then I went back and did the secretarial course. That was a year's course.Man: And then you got the job at the travel agency I suppose.Woman: Yeah, that's right. That was in 1991.Man: So you were there for five years!Woman: Yes, it's awful, isn't it? Actually, I'm thinking of giving it all up to become a nurse.Man: Really?Woman: Well, I worked in a hospital in Twickenham during my last year at school. Just cleaning and helping to make bedsand so on. It was part of our Practical Careers training.Man: And you liked it?Woman: Yes, it was interesting.Exercise1. A2. D3. C4. A5. DListening IIIMan: Well, now then, one thing I'd like to ask is, er, exactly why you applied for the job. I mean, just looking at your application form, you're actually over-qualified...Woman: Yes, I thought you might ask that. Um, the thing is, in my present job, although I'm actually in charge of a small team and I have a lot of responsibility, it's largely a desk job with a lot of paperwork...Man: And you're not too keen on being stuck in an office all day?Woman: To be honest, no, I'm not. I much prefer being out on site where I can supervise things, and deal with problems as they occur. And this job should give me the kind of contact with other engineers, architects, builders and so on.Man: Mmm. You'd certainly have to do quite a lot of traveling in the local area, you know, visiting different sites. You do realize, though, that the starting salary isn't as good as the salary in your present job?Woman: Yes, I realize that, but um, it does say in the job advertisement that the promotion prospects are very good.Man: That's true, and er, as this is a new project that we'reworking on, we think there'll be a very good chance of fairly quick promotion, depending on performance, that is...Woman: Yes, of course. Well, you see, I've got very little chance of promotion in my present job.I mean it's a very small company and there's nowhere really for me to go; that's why I'm looking around for somewhere else.Exercise1. C2. B3. D4. C5. AListening IVDavid: Hi! You're listening to Radio Southwest, the best in the southwest for music andup-to-the-minute news. Sue's here. Hello, Sue.Sue: Hello, David.David: And we've got the Jobspot for you today. So, if you're looking for a new job, this could be the spot for you. So, let's have a look, and see what we've got today.Sue: Well, the first one we've got is a cook. That's in a large, busy restaurant, so it's very useful to have had experience in cooking. Must be a high school graduate and the pay is $12 an hour. So that's not bad, is it? The hours are good too. That's Monday to Friday, 3:00 p.m. till 6:00 p.m.David: Great. Thanks, Sue. So that's a cook. Now, how do you fancy working out of doors? How do you fancy being a gardener? So as long as you're fit and strong, and at least 16 years old, that'll suit you. The pay is $8 an hour. And the hours, Tuesday to Saturday, 8:30 a.m. to 5:00 p.m., you have to work on Sundayonce a month, but on Monday the Garden Center's closed. Now, the sort of work you'd be doing is potting, watering, things like that. So, how about applying for that? Pay, $8 an hour. Sue, what else have you got?Sue: Right, Dave. Well, from outdoors to indoors. We've got a word processor operator job here. This job might suit a woman with school-age children, because the hours are only 15 hours a week. It's a small, friendly office, and they require a high school graduate with two years' experience operating a computer. Pay is $9 per hour. So, there you go. That's a nice job in an office. If you fancy any of those jobs, give us a ring here on Jobspot at Radio Southwest. And now back to the music.Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACE。

UNIT1Part1C: 1)g 2) i 3) d 4) a 5) f 6) h 7) e 8) c 9) b 10) jD:TFTTE: segment 11．Facebook, 24, more than 30 billion2．difficult, rapid3．television,investors4．Bill gatesSegment 25．a cafe, seven6．Free timeSegment 37．one third,half8．30,bankruptcySegment 49．marriage/family life10．divorced,choseF: 1. It is very hand work to have your own business.2.There is no guarantee of becoming rich as a business owner.3.You have to make difficult choices between family and work.Part2A:1)b 2)a 3)c 4)bB:(1)get read for work (2)never (3)sense of power (4)12 (5)desire for power(6)a leader (7)fist restaurant (8)fighting with the chef (9)hing(10)speed(11)second year (12)shut the restaurantC:1)a 2)b 3)d 4)bD:1. the chef the wait staff2.brighter than me out of their way3.daring and creative new challenges new ideasE:1)c 2)b 3)c 4)bF:FTFTG:1)d 2)a 3)b 4)bH:1. $50,000 to $80,000 a month.2.To finish school and become a doctor.3.His company was making $66 million a year .4.Dell is one of the largest computer companies and earns nearly $80 billion ayear.5.He did not have a passion for computers and drive to succeed in business Part4C: 1) c 2)b 3)a 4)b 5)a 6)b 7)a 8)a 9)c 10)aD: 3,4,5E: Segment 1:1.By taking life and education seriously for 17.Segment 2:2.Choices you will have to make.3.Make mistakes.4.Decision-making.Segment 3:5.Yes.6.To work hard for more success.Segment 4:7.Yours.8.Celebrate your achievement.G: 1)b 2)b 3)c 4)c 5)a 6)bUNIT 2Part 1C: 1. i 2. d 3. a 4. e 5. h 6. c 7. g 8. f 9. b 10. jD: 2,4F:b,f,c,a,e,dG:segment 1:1.Simple pictures.2.Punctuation or other non-letter symbols.3.A combination of two words to make one word.4.Basketball/Sunlight.5.Picture.6.Character.Segment 2:7.Facial expressions and gestures.Segment 3:8.Abbreviations.9.“u” for you.Part 2A: 1)c 2)b 3)c 4)dB:1. 5.2 billion.2.Inherited knowledge , diversity, the culture of former speaker3.Awareness, endangered language-preservation projects.4.Record and upload.5.Hear the words, learn the language.C:1)b 2)c 3) dD:1)T 2)F 3)F 4)F 5)FE:1)a 2)b 3)bF:1. They enjoy playing with the language and actively invent new vocabulary,2.To express new ideas and objects.3.Because England was once ruled by French-speaking Normans.4.By using prefixes and suffixes.G:1)d 2)a 3)cH:2. invented to describe sounds and the things that make sounds;also invented byrepeating a sound with a small change.3. invented by reducing phrases.4. the shortening of a longer word,often reducing it to one syllable.5. combining elements from two words.Part 4B:1,2,C:1)c 2)b 3)b 4)c 5)c 6)b 7)a 8)a 9)a 10)aD:4.E: a:1b:2, 3,5C:4, 6F:segment 21.T2.FSegment 33.T4.F5.T6.FG: segment 1: cSegment 2: aSegment 3: b,d,eSegment 4 :d,eH:1. boutique2.Thunderstorm3.Camcorder4.Flame5.LOLUNIT3Part1C:1) h 2) j 3) c 4) b 5) d 6) g 7) e 8)a 9)f 10)iD:1, 3, 5,8,E:Dogs: 1, 2, 3, 5, 6, 10,Rates:4, 5, 6, 9,Ravens:3, 5, 7, 8, 9,F:segment1: who used dogs for search and rescue in the 17th century?Segment 2: what other skill did the dogs have?Segment 3: what kind of technology are they using?Part 2A:1)c 2)b 3)d 4)bB:1. it was a magnitude 7.0 earthquake.2.Three million.3.An immediate response to the crisis.4.Crisis mapping.5.Crowd-sourced data.C:1)b 2) b 3)a 4)cD:1. gym2.Black3.154.1685.High energy6.FocusE:1)b 2)b 3)c 4)bF:1.can, a force for good in society, yes, it can2.does, help many people, yes, a force for goodG:1) T 2)F 3) T 4)T 5)T 6)FH:1)b 2)b 3)c 4)aI: 1. 2013, small earthquake2.saving many lives.3.water, food and tents.4.500 tents, 1250 blankets, earthquake survivors.5.nearly,health,Part 4D:1)b 2)a 3) b 4)a 5)b 6)c 7)a 8)b 9)a 10)aE:1, 2,G:1.a,b,e,h,k2.a,b,f,h,k,3.a,c,j,h,i4.a,d,h,j,UNIT 4Part 1C:1)b 2)a 3)c 4)b 5)c 6)c 7)b 8)c 9)a 10)aD:1) N 2) T 3) F 4)F 5)T 6)FPart 2A:1)c 2)a 3)b 4)c 5)dB:(1)born (2)5 (3)father (4)looking after (5)10 (6)farmland (7)40(8)cook (9)fried (10)steak (11)gas station (12)gas station (13)motel(14)66 (15)restaurant (16)spices (17)KFC (18)second (19)restaurant(20)20000 (21)hot (22)adaptable (23)hotC:1) c 2)a 3)c 4) c 5)bD:1.eliminate, how you limit yourself, input2.Focusing only on your strengths and denying your weaknesses.3.They may not always be accurate.E:1)a 2)c 3)bF:1) F 2)F 3)T 4)FG:1)c 2)d 3)a 4)bH: example one(1)disease (2)speak (3)control (4)left leg (5)child (6)write (7)draw(8)painter (9)best-selling writerExample two(1)slave (2)united states (3)forbidden (4)read (5)write (6)bread(7)reading lessons (8)escape (9)freedom (10)salve (11)leaders(12)slavery (13)autobiography (14)best seller (15)persuaded(16)abolish slaveryPart 4D:1) T 2)F 3)T 4)T 5)T 6)F 7)T 8)F 9)T 10)FE:1. 2. 3.F:d.g.f.e.a.b.c.UNIT5Part1C:1) b 2)g 3)i 4)c 5)d 6)h 7)j 8)e 9)f 10)aD:1.c 2.b 3.a 4.b 5.bE:segment 1(1)heart (2)blood (3)rate (4)brain (5)muscles (6)fastSegment 2(7)releasing (8)stress (9)high (10)relax (11)killPart 2A:1)b 2)b 3)c 4)cB: To sign up for activities promising stress relief ,to learn new techniques toCope with stress ,and to find all means and ways to manage their stress.D:2对E:1)b 2)bF:1.In 20182.It assessed the primary and junior high school education sectors in China.3.Advanced preparation4.The desire to succeed remains fierce among Chinese students and parents.G:1)c 2)b 3)d 4)d 5)aH:Tip 1: (1)break (2)listen to some musicTip 2:(3)exercise (4)play basketballTip 3:(5)laugh and smile (6)a comedy (7)read a humorous storyI:1)c 2)c 3)bJ:Tip 4:(1)reach out to others (2)talk to (3)send them a letter or an emailTip 5:(4)sit quietly (5)think about (6)the waters rushing by (7)all yourworrier awayK:1.对Part 4C:1)a 2)a 3)b 4)b 5)b 6)b 7)c 8)bD:1)b 2)c 3)a 4)a 5)aUNIT 6part 1C:1. b 2.j 3.d 4.c 5.e 6.i 7.f 8.h 9.a 10.gD:2.对E:1: e, g2: h, c3: a, b, i, d, fF:(1)human life (2)Fishing (3)more than 500 million (4)food (5)work(6)protect (7)barrier (8)coast (9) they prevent or reduce (11)scuba diving(12)scientific (13)medicines for (14)contribute (15)30-1723H:(1) reefs (2)so (3)to (4)ocean (5)health (6)habitats (7)lots(8)of (9)species (10)can (11)you (12)link (13)directly (14)to(15)ocean (16)healthPart 2A:1)c 2)c 3)dB)1. nearly 900 dolphins.2.Bleeding and fractures in dolphins’middle ears,and probably decompressionsickness.3.It can cause then to die.4.The ability to identify predators.D:1)b 2)b 3)c 4)cE:1.In the ocean.2.For about 40 years.3.Water and noise pollution,overfishing, heavy water traffic and the reduction offree-flowing water.4.The government designated important ecological areas along the river.F:1)a 2)d 3)bG:(1)70% (2)half of the oxygen (3)the climate (4)most of our rain(5)global warming and climate change. (6)natural remedies(7)get their income (8)more than one billion.J:(1) ocean garbage (2)trapped and die (3)plastic (4)humans (5)floats(6)plastic (7)one place (8)lift (9)water (10)recycling (11)acidification(12)CO2 (13)CO2 (14)shellfish (15)plants (16)CO2 (17)oxygen(18)bubbles (19)CO2 (20)escape (21)escapeK:1)c 2)d 3)d 4)a 4)aPart 4D:3.4.5.E:1)F 2)F 3)F 4)T 5)F 6)T 7)F 8)F, T 9)TG:segment 1 1)a 2) b Segment 2 2)c 4)b Segment 3 5)b Segment 4 6)A。

新编大学英语视听说 book3 Unit 6听力答案与文本1Unit 6Part 1Listening IWoman: Why do you think people are afraid of tarantulasMan: Well, I guess it's because people are afraid of all spiders, and tarantulas happen to be the biggest of all the spiders. And maybe it's also because some spiders really are very poisonous. In California, for example—in most of the garages in California—you get black widows, which are quite small but certainly more dangerous than tarantulas. Woman: But personally you aren't afraid of tarantulasMan: Well, I shouldn't be frightened of tarantulas, simply because I know that they aren't really dangerous —all they can do is give you a small bite, but it's not poisonous. And yet I must say I don't like to pick them up. But you see, some people keep pet mice and pet rabbits and, well, they can give you a much worse bitethan a tarantula ever could. And yet people aren't frightened of them.Woman: Why do you think people are frightened of spidersMan: I don't know—it's very strange. People are frightened of spiders and they are frightened of snakes, and, well, obviously some spiders and some snakes really are poisonous. But most snakes are harmless, and it's really strange that people are so frightened of spiders because it's quite difficult to find a spider that's really dangerous.Exercise 11. B2. C3. D4. B Exercise 21. T2. F3. F4. FListening IIShop Assistant: Good afternoon, madam. Can I help youCustomer: Yes. I'm looking for a pet for my son. Can you suggest anythingShop Assistant: What kind of pet does he want A traditional pet, a cat...or a dog Or something unusual Customer: Well, he'd like a snake or a crocodile,but he isn't going to get one. Shop Assistant: We've got a nice Alsatian at the moment.Customer: An Alsatian Did you say \They're very big and savage.Shop Assistant: Oh, no, madam. They aren't as savage as some dogs. Customer: ReallyShop Assistant: Oh, yes. Last week we had a small dog. It was only as big as your handbag, but it was as savage as a tiger—it bit me three times! Customer: Perhaps not a dog, then. Shop Assistant: How about a catCustomer: A cat Hmm...they aren't as friendly as dogs, are theyShop Assistant: No, but they don't eat as much as dogs either. And they're very clean. They wash themselves every day. Customer: Hmm...Shop Assistant: Or how about a bird A parrot or a budgie We have both. Customer: Which do you rexxmend Shop Assistant: Well, budgies aren't as easy to train and they never speak as well as parrots. Customer: Yes, but budgies don't need as much space as parrots, do theyShop Assistant: That's true. Budgies are very popular because they are so easy to keep. Customer: Yes...but they're a bit noisy, aren't they I want a quiet pet.Shop Assistant: A quiet pet Well, how about a goldfish There's nothing as quiet as a goldfish.Exercise 11. snake, crocodile2. parrot, budgie3. quiet4. goldfish Exercise 21. A2. D3. A4. C5. AListening IIIOver 450 wild horses have been killed in Nevada. The land they were on belonged to thegovernment. Some people say it is worse than when all the buffaloes were killed. Many of the horses were shot while running.Wild horses are protected by law. 28 thousand wild horses share the land with six million cattle. Cattlemen say the horses are crowding the cattle out. It is said that there is a war going on. Both the cattle and the horses need the water and grass that is on the land.The president of the Nevada cattleman group also helps to protect the horses. He says that he does not like what is happening to the horses. He does want the government to help keep the number of horses low.Some people think the Navy used the wild horses for target practice. Pilots flew over the area where the horses were found. The Navy said that they did not let their pilots do that.The horses were found far from the nearest road. The killings happened over a large area. It has been happening for the last two years.Some people think that the horses should be gotten rid of. Others think that they should stay. In the meantime, the police will try to figure out who killed the horses. Questions:animal has been killed in Nevada recently is the number of the animals killed long has the killing lasted did the killingExercise 11. C2. A3. BExercise 21. crowding , war, water, grass2. what ishappening, keep the number of horses low 3. target practice, where the horses were found 4. gotten rid of , stayListening IVNarrator: I'm going to tell you about an extraordinary thing that happened the day before yesterday, about eight o'clock at night, a young woman approached the box office of the best movie theater in the city. She had with her an enormous dog with a beautifully groomed coat. She bought two tickets and went toward the door, followed by her dog. The manager of the theater spoke to her...Manager: I'm sorry, Miss, but dogs aren't allowed in this theater. Girl: But I have a ticket for him.Manager: I'm very sorry, but animals aren't permitted.Girl: You don't understand. This is a special case. My dog is so well trained and so intelligent that he's almost human.Manager: I see that you have an exceptional animal, but...Girl: I promise you that if there is any problemwe'll leave the theater immediately. I assure you that this dog isn't like any other dog you've ever seen.Manager: Well, all right. I'll let you go in, since the theater is almost empty tonight. Nevertheless, your dog will have to behave himself, or you will have to leave.Narrator: About two hours later, and now the people are leaving the theater. The manager sees the girl with her dog.Manager: I congratulate you. You are right; your dog behaved very well. I've been watching him, and it's amazing how quiet he was.Girl: I told you that he's well trained and very intelligent.Manager: He certainly is. It even seemed as if he was enjoying the movie.Girl: Oh, he did enjoy it. He liked the film very much. However, he liked the book much better. Exercise 11. F2. T3. F4. T 8. F Exercise 2 4 6Part 2Exercise 11. D2. A3. B4. C5. C6. A Exercise 21. farm animals, hold, feed2. small pets, toys3. bury, toss them out4. real shame5. dangerous, destructive, bring diseases6. havea point 7. humanely, limit8. time, money, warm place 9. isolated, xxpany 10. storm of debatePart 3Exercise 11. A2. D3. D4. B5. A6. C7. A8. B Exercise 21. female, collectively2. not a moment3. infinite care up, left to right 5. struck, smarter 6. salt water lake, dock 7. self-aware, non-human intelligence, belong in captivityPart 4Further listening Listening 1Many people around the world bexxe friends with animals. Some call their pet animals byhuman names. They treat them like members of thefamily. Scientists now are proving what many pet owners already know—pets are good for your health.The Delta Society is a research center in the northwestern state of Washington. They say animals have a healthy effect on people, especially people who are sick and lonely.Several years ago, the Delta Society developed a program called \people work in pet therapy programs throughout the country. They take animals to visit people in hospitals, prisons and private homes. Dogs and cats are taken most often. But other visitors include snakes, rabbits, horses and birds. Some of the animals stay with the people forever. The dolphin also has a good effect on people. Scientists at the Dolphin Research Center in Florida introduce sick people to playful dolphins. People feed the dolphins, touch them, and ride on the dolphins' backs in the water. In this way, the animals help the patients feel better.The head of the Delta Society, Linda Hines, says one reason for the pet therapy is that animals help sick people get better. Also, she says the animals have a calming effect on people, because pets can help peopleforget their own problems.Exercise 1 1. Exercise 21. A2. C3. C4. AListening II1Unit 6Part 1Listening IWoman: Why do you think people are afraid of tarantulasMan: Well, I guess it's because people are afraid of all spiders, and tarantulas happen to be the biggest of all the spiders. And maybe it's also because some spiders really are very poisonous. In California, for example—in most of the garages in California—you get black widows, which are quite small but certainly more dangerous than tarantulas. Woman: But personally you aren't afraid of tarantulasMan: Well, I shouldn't be frightened of tarantulas, simply because I know that they aren't really dangerous —all they can do is give you a small bite, but it's not poisonous. And yet I must say I don't like to pick them up. But you see, some people keep pet mice and petrabbits and, well, they can give you a much worse bite than a tarantula ever could. And yet people aren't frightened of them.Woman: Why do you think people are frightened of spidersMan: I don't know—it's very strange. People are frightened of spiders and they are frightened of snakes, and, well, obviously some spiders and some snakes really are poisonous. But most snakes are harmless, and it's really strange that people are so frightened of spiders because it's quite difficult to find a spider that's really dangerous.Exercise 11. B2. C3. D4. B Exercise 21. T2. F3. F4. FListening IIShop Assistant: Good afternoon, madam. Can I help youCustomer: Yes. I'm looking for a pet for my son. Can you suggest anythingShop Assistant: What kind of pet does he want A traditional pet, a cat...or a dog Or something unusualCustomer: Well, he'd like a snake or a crocodile, but he isn't going to get one. Shop Assistant: We've got a nice Alsatian at the moment.Customer: An Alsatian Did you say \They're very big and savage.Shop Assistant: Oh, no, madam. They aren't as savage as some dogs. Customer: ReallyShop Assistant: Oh, yes. Last week we had a small dog. It was only as big as your handbag, but it was as savage as a tiger—it bit me three times! Customer: Perhaps not a dog, then. Shop Assistant: How about a catCustomer: A cat Hmm...they aren't as friendly as dogs, are theyShop Assistant: No, but they don't eat as much as dogs either. And they're very clean. They wash themselves every day. Customer: Hmm...Shop Assistant: Or how about a bird A parrot or a budgie We have both. Customer: Which do you rexxmend Shop Assistant: Well, budgies aren't as easy to train and they never speak as well as parrots. Customer: Yes, but budgies don't need as much space asparrots, do theyShop Assistant: That's true. Budgies are very popular because they are so easy to keep. Customer: Yes...but they're a bit noisy, aren't they I want a quiet pet.Shop Assistant: A quiet pet Well, how about a goldfish There's nothing as quiet as a goldfish.Exercise 11. snake, crocodile2. parrot, budgie3. quiet4. goldfish Exercise 21. A2. D3. A4. C5. AListening IIIOver 450 wild horses have been killed in Nevada. The land they were on belonged to thegovernment. Some people say it is worse than when all the buffaloes were killed. Many of the horses were shot while running.Wild horses are protected by law. 28 thousand wild horses share the land with six million cattle. Cattlemen say the horses are crowding the cattle out. It is said that there is a war going on. Both the cattle and the horses need the water and grass that is on theland.The president of the Nevada cattleman group also helps to protect the horses. He says that he does not like what is happening to the horses. He does want the government to help keep the number of horses low.Some people think the Navy used the wild horses for target practice. Pilots flew over the area where the horses were found. The Navy said that they did not let their pilots do that.The horses were found far from the nearest road. The killings happened over a large area. It has been happening for the last two years.Some people think that the horses should be gotten rid of. Others think that they should stay. In the meantime, the police will try to figure out who killed the horses. Questions:animal has been killed in Nevada recently is the number of the animals killed long has the killing lasted did the killingExercise 11. C2. A3. BExercise 21. crowding , war, water, grass2. what is happening, keep the number of horses low3. target practice, where the horses were found4. gotten rid of , stayListening IVNarrator: I'm going to tell you about an extraordinary thing that happened the day before yesterday, about eight o'clock at night, a young woman approached the box office of the best movie theater in the city. She had with her an enormous dog with a beautifully groomed coat. She bought two tickets and went toward the door, followed by her dog. The manager of the theater spoke to her...Manager: I'm sorry, Miss, but dogs aren't allowed in this theater. Girl: But I have a ticket for him.Manager: I'm very sorry, but animals aren't permitted.Girl: You don't understand. This is a special case. My dog is so well trained and so intelligent that he's almost human.Manager: I see that you have an exceptional animal, but...Girl: I promise you that if there is any problem we'll leave the theater immediately. I assure you that this dog isn't like any other dog you've ever seen.Manager: Well, all right. I'll let you go in, since the theater is almost empty tonight. Nevertheless, your dog will have to behave himself, or you will have to leave.Narrator: About two hours later, and now the people are leaving the theater. The manager sees the girl with her dog.Manager: I congratulate you. You are right; your dog behaved very well. I've been watching him, and it's amazing how quiet he was.Girl: I told you that he's well trained and very intelligent.Manager: He certainly is. It even seemed as if he was enjoying the movie.Girl: Oh, he did enjoy it. He liked the film very much. However, he liked the book much better. Exercise 11. F2. T3. F4. T 8. F Exercise 2 4 6Part 2Exercise 11. D2. A3. B4. C5. C6. A Exercise 21. farm animals, hold, feed2. small pets, toys3. bury, toss them out4. real shame5. dangerous, destructive, bring diseases6. havea point 7. humanely, limit8. time, money, warm place 9. isolated, xxpany 10. storm of debatePart 3Exercise 11. A2. D3. D4. B5. A6. C7. A8. B Exercise 21. female, collectively2. not a moment3. infinite care up, left to right 5. struck, smarter 6. salt water lake, dock 7. self-aware, non-human intelligence, belong in captivityPart 4Further listening Listening 1Many people around the world bexxe friends with animals. Some call their pet animals byhuman names. They treat them like members of the family. Scientists now are proving what many pet owners already know—pets are good for your health.The Delta Society is a research center in the northwestern state of Washington. They say animals have a healthy effect on people, especially people who are sick and lonely.Several years ago, the Delta Society developed a program called \people work in pet therapy programs throughout the country. They take animals to visit people in hospitals, prisons and private homes. Dogs and cats are taken most often. But other visitors include snakes, rabbits, horses and birds. Some of the animals stay with the people forever. The dolphin also has a good effect on people. Scientists at the Dolphin Research Center in Florida introduce sick people to playful dolphins. People feed the dolphins, touch them, and ride on the dolphins' backs in the water. In this way, the animals help the patients feel better.The head of the Delta Society, Linda Hines, says one reason for the pet therapy is that animals help sick people get better. Also, she says the animals have acalming effect on people, because pets can help people forget their own problems.Exercise 1 1. Exercise 21. A2. C3. C4. AListening II。

Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. BarbaraExercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600 Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5.travel around in 6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign language Practice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice Two(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7.records 8. agree 9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。

Keys to the texts of book3Unit sixPart OneExercise 2 :1. d2. a3. b4.c5. c6. aExercise 31. farm animals; hold; feed2. small pets; toys3. buy; toss them out4. real shame5. dangerous; destructive ; bring diseases6. have a points7. humanely; limit8. time; money; warm place9. isolated; company 10. storm of debatePart TwoListening IExercise 11. b2. c3.d4. bExercise 21 T 2. F 3.F 4. F 5. T 6. TListening IIExercise 11.Her son.2. snake; crocodile3.quiet4.picky/particular Exercise 21. big2. dogs3.tiger4. bit5. cat6. friendly 6. eat 8. clear 9.wash 10.space 11. noisy 12. train 13. speak 14.keep 15. quietPart ThreePractice oneExercise 1(1,4,5,6,7,) yesExercise 21 a 2.b 3.c 4.a 5. dPractice TwoExercise 1(1,3)yesExercise 21. for free2.small donation3. 204. hundreds5. eat little6.50 7. animal shots 8. numerous shots 9. diseasesPractice ThreeExercise 11.c2.b3.d4.c5.aExercise 2(2,5.6.7) yesPractice FourExercise11 c 2.c 3. a 4.b 5. dExercise 21.crowding water; grass;2. what is happening; low3.targetpractice; over the area4. gotten rid of; stayPart Four Testing yourselfSection I1.f2. t3. f4. t5. f6. t7. t 8. f 9. f 10. tSection II1. a2. c3. d4. b5. b6. bSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5000 12. embarrassed 13. advertise the furs 14. export bans 15. importation 16.turtleKeys to the texts of book3Unit sevenPart OneExercise 2 :1. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery ;historic interest3. Summer ; too cold4. long history ; vast territory5. feed the monckys6. as many places as possible.7. you name it8.. host city ;ancient civilization; modern architecture9. city wall; treat yourselves 10.express train Part TwoListening IExercise 11 c 2. b 3. b 4. c 5. d 6. aExercise 21. SN 862 17:50 on July 112. SN863 15:10 on July 14 Listening IIExercise 1(B.C.F.G.H.I) yesExercise 2Part one 1.F 2. T 3.T 4.T Part two 1.F 2.F 3T 4.F Part three1.T2.T3.T .4.T5.FPart ThreePractice oneExercise 1Advantages: ADH ; disadvantages: EExercise 21 c 2.d 3.b 4. cPractice TwoExercise 11. seedypany3.shared4. noisy5. early6. private7. booking8. convenient9. restaurant 10.bathroomsExercise 21. T2. F3. T4. T5.6. TPractice ThreeExercise 11. Fuel2. Water3. Vehicles4. ClothesExercise 21.passing lorries 6. self-sufficient2.enough water 7. car repairs3.drinking 8. cost much4.vehicle 9. sweaters5.emergency 10. European winter Practice FourExercise1a. actress Bb. actress and author A1. a2.b3.b4. a5.b6. a7. a8. b Exercise 21.T . F 3. F 4. F 5. F 6. T 7. F 8.TPart Four Testing yourselfSection I1.F2.T3.T4. T5. FSection II My history teacher1. b2. c3. c4. c5. a6. dSection III1. d2. b3.c4. d5. aKeys to the texts of book3Unit eightPart OneExercise 2 :Section A5,7,1,4,6,3,2Section B1)F H I 2)A 3) C E J 4) B D G JExercise 31.passed out; in shock2. back and forth3. knows the reason why4. no doubt; living without her5. plays a great role6. brilliant boy7. very few cases8. deny; nature9. bright or not; should; CAN 10. thicker than; genetic relationship 11. react to; not to mention 12. hard decision; involvedPart TwoListening IExercise 11 F 2. F 3. T 4. F 5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed 8. language 9. young 10. alike 11. separated 12. apart 13. career 14. interestsListening IIExercise 11.b2.d3. a4. dExercise 2(1,4,6,8,10,11,12 ) yesPart ThreePractice oneExercise 1(3,6,9) yesExercise 21. six2. four3.1954. broad5. slim6. extended7. short8. elbows9. knees 10. size-14 11. lungs 12. heartPractice TwoExercise 11. 19212. fit the child3. ordinary schools4. adult conception5. BarbaraExercise 21. good being2.wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction9. scholars 10. scholars 11. street cleanersPractice ThreeExercise 11. c2.b3. c4. bExercise 21 F 2. F 3. T 4. F 5. FPractice FourExercise11 a 2. c 3. d 4. aExercise 21.F2. T3.T4. T5.T6. TPart Four Testing yourselfSection I1.talent2.dancing3.creative4. early5. physical6. energy7. less8. curiosity9. particularly 10. cause 11. fundamental 12. meaning 13. superior 14. fluently 15. read 16. exceptional 17 preparation 18. fullySection II1.F2. T3. F4. F5. T6. F7. F8. TSection III1. c2. a3. c4. b5. dKeys to the texts of book3Unit NinePart OneExercise 2 :1. c2. c E3. .c4. w5. w 6 c 7. c 8. c 9.c 10. w 11. w 12. w 13. c 14. w 15. w 16. c 17. w 18. wExercise 31.prefer; old- fashioned2. as old as3. account for4.own; play; earn a living5. very proud of6. had the chance7. hills; small bridges; singing of birds8. full of energy9. holes; buttons; precise; notes 10.indirectly; individualistic 11. places great importance on 12. a universal languagePart TwoListening IExercise 11 restaurants, airports supermarkets; banks 2. attitudes; in the right mood ; a better feeling; the people around him; happy; work better 3. world war II 4. happy; calm ; a machine; kinds of music ; different times; faster ; slowerExercise 21. T2. F3.F4.T5.T6. F7. T8.FListening IIExercise 11.eases their minds; operations2. classical; instrumental Jazz;folk music 3. reduce tension; 50 male doctors; Mathematics ; 1. quickly 2. calmly 3. chosen for them 4. no music 5. the worst sleepyExercise 21. T2. F3.T4. F5. FPart ThreePractice oneExercise 11. b 19622.d 19633.a 19644. c 1970Exercise 21. their own style2. the nature3. sounds; experimented4. songs; records5. films ; awardsPractice TwoExercise 11. (1) (2) (3)2.(2) (1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the string5. manages the bowExercise 3.1. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice ThreeExercise 11. T2. T3. T4. F5. F6. F7. F8. TExercise 2。

Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly BExercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. T Exercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 T Practice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection II1. B2. B3. D4. B5. D6. A7. C 8. BSection III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond8) independent9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. C Exercise 21. T2. F3. T4. T5. F6. F Listening III Exercise 11) stayed around 2) mouse catcher 3)rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7.F 8.TPractice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. D Practice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. A Exercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7.F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction4) species5) oxygen 6) economic 7) conservation8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa￥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. F Exercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. B Exercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.T Exercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by10. sense11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. A Exercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debate Part TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particularExercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.D Exercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory10. reduced11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. A Exercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages E Exercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking 8. convenient 9. restaurants 10. bathroomsExercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7)A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. D Section III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5，7，1，4，6，3，2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.T Part Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16.C 17. W 18.WExercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slowerExercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makesthe notes4. on the strings5. manages the bow Exercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. TExercise 2Bruce Springsteen: communicative, direct, exciting, simplerSting: naturalPeter Gabriel：musicalBranford Marsalis: brilliant, humorous Youssou N’Dour：not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damaged Exercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days 8. give up 9. stop trying10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. A Section II 1. C 2. B 3. D 4.A 5. B Section III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black11. white 12. shaking 13. wet 14. sweet15. delicious16. angel 17. grave 18. nights 19. days 20. taste。