新编大学英语(浙大)视听说第3册听力原文和答案
- 格式:doc
- 大小:501.50 KB
- 文档页数:72
Unit 1PART 1Listening 11. FFTTFT2.outside worldat homewave hellobowlook straight into the eyesopenlylook at my feetshy and silentListening II1.1.sensitive independent2.good friend3.life people4.learning being aware2.BCADBListening III1.1.ice-skating2.chemistry3.outgoing, bright, funny4.self-centered5.blond medium height6.runner-up2. TFTFFLstening IV1.1. Four2.Colleagues3.Teacher./Teaching4.Susan5. To go on holiday2.1.Paul:DEJ2. Susan: B F3. Maria: C H4. Peter: AGIPART 21.1.Mike C2Sam E3.Ted D4.Simon A5.Lilly B2.avoid confrontationgenerally likeablehide those traitsaffectionate kind nature stubbornnessworst reputationrevengeful and destructive entertainingtough and determinedintuition and protective nature perfectionistsdraw attentionPART 31.1. The lunar calendar2.Two trines3.Four trines2. who is very good with money who is easily angereddisplay the utmost amount of energy longest life and good fortunewith quick witgreat common senseinspires leadership in others seductive and charmingdeep-thinking and very talented interesting and bravePART 4Listening 1upsetsensiblelecturecalmstrengthlandedswearingperfectlywildlybeeListening II1.BDAACCDCListening III1.1 PELedro C2 Mr. Miller C3. Mr. Smith E4 Jake A5 Mrs. Duke F2.1.favorite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoop Listening IV1.FTFFT2.understand the Scots' English the friendliest peoplemuch nicer thanEngish courtesyno views on the matterUnit 2Listening I1. BABD D(最后一个答案存在疑问,应选C,请读者参考听力录音确认)2. FTTFTListening II1. AABCD2. TFTTFFListening III1.1) stayed around2)mouse catcher3)rats and mice4)got a paw5)weak and thin6)make a wooden paw7)fastened it8)grow sleek and fat9)managed10) peered out cautiously11)seized it with12) 18 miceListening IV1. BDAAC2. FTTTFTFFPART 21.1 C2 E3 D4 B5 A2. in your handused to belong topracticing withtalked to each otherwhy notask forfind a waymanage tohis own loveso foolishly jealousall three of thempeacePART 31. DCABA2.InvadesheltersupplypeacewithdrawflaghangedremembersecretsharequeenPART 4Listening 11. BCBADA2. FFTTFListening II1. 1. CDJ2.AEGH3.BFI2. ABDCBDListening IIITFFFTFTTListening IVassociatedrailroadmerchantdictionariesgrasslandsbringactionOne hundred days after his offer was made, the first herds arrived from the South.Soon there were at least 5000 cowboys bringing cattle up to Kansas from Texas.These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3Part 1Listening 11. BCDA2. FTFTFTListening II1. BDAD2. 30smale190long wavyheavily builtlight red sweaterbeardListening III1. BCAC2.lovetogethermotherhouseschoolfriendsfathermonthbeachcallListening IV1. Stories music next door in love with secretary fights3×4 √2. Celia: 1 √2 √3×4√Sara 1×2 √ 2×3×4√Jack 1 √ 4×Tom 1√2 √ 3√PART 211D 2C 3 B 4 E 5 A3. TFFTTTTTFFPART 31.a central bodytransport visionaccessa race trackslightly slowerhuge success2. car movementcyclingwalkingstrategiesquality of lifevisit the cityinvestmentdesignenvironmentsubtle designfocusPART 4Listening 11.FTFT2.South Americapet foodenough proteindevelopmuch moreAfricapositionnatural resourcesgone downsteadycontinued to risegetting richer and richerListening II1.the first few secondsso thinbeings from another planetfocused onlooked directly atAll arounduntil nowdespair grief and disguststarted cryingwho was sleeping peacefully6×7×8√2. 1√2 √3×4 √5√Listening IIIComplainedworkchestshockedcold-bloodedinvestigationdealingHe had mentioned his concern twice to the local officialWhenever this topic arose he always expressed strong views about drugs.ted to the murder.But it’s still early to say this is relaListening IVpovertycrimedriftbetter workresentmentattractiveeducation servicesa more positive attitudeUnit 4Part 1Listening I×,8√1 1×,2√,3×,4√,5√,6√,721)weaknesses,2) similar abilities and interest, interest you, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combinationListening II1.DDAB2.1)import from abroad 2)sales manager 3)salary 4)sales commission5) travel in 6)experience 7)university 8)on a teamListening III11)Choose their careers, 2) avoid certain careers3) different professions, 4) impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance 2 TFTFTListening IV1.C A C B D2.1)occupation cool2)catch provide fulfilling3)media coming after you make your own work schedule4)have my pick of jobsPart 2×K√L√1. A√B√C×D√E×F√G×H√I√J2 1) computer engineering, 2) computer programmer, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical research, 9) management, 10) 3600Part 31.A√B×C√D√E×F√G×H√2.1)tremendous element of care, what kinds of contributions2)where you’re from3)professional learning, colleagues, peers4)what makes their students tick5)relaxed, care about them, passionate, developPart 4Listening I1)100 million2)35, 403)seven, eight4)office workers, many professionals5)8:00, 4:006)eight-hour shifts7)Monday, Thursday, Saturdays, Sundays8) choose their own working hours, freedom of choice, happy withListening II1.ADCADListening IIICBDCAListening IV1. CABDB2.1) ADF2)BF3)ACEUnit 5:Part 1:Listening 1:1.1.plays, real people real life, emotional, problem, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kind2. F F T T T TListening II:1. 1 C 2 A 3 D2.1.be understood easily2.necessary desirable3.splendid4.prevents, from achieving5.anxiety, effectListening III:1.1.T2. F3. F4. F5.T6.T21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IV:11. C2. C3. A4. B21.eggs, toast2.realistic, far better than, forgetting3.determined, personality culture4.recite aloudPart 2:1.1-B 2-A 3-C 4-E 5-D 6-F2.1.over long distances2.look into it3.five times4.individual group5.sex-specific males females strangers6.great apes7.teach own kind8.raised held look bigger9.round tail-wagging10.feeding every directionPart 31.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.Johned joined6.Siji…Siji Delaney Sinjin Delaney7.Awful lawful8.Spigot spiritPart 4Listening 11.Economic2.religions3.exist4.biologically5.40,0006.cave7.Written8.humans were probably speaking thousands of years before that9.Even while we are reading or just thinking, we are in a sense“talking”nguage is so much a part of human existence that we will betalking as long as we inhabit the Earth.Listening II1. D A B B A2.1.Permission apply for2.application form website3.regular mail faxcredit cards4.traveler’s checksListening III1A×B√ C √D×E√21)Other native languages2)two3)more4)of their choice5)Spanish6)Indians7)English German FrenchListening IV1.1.learner teacher curriculum2.Curiosity expectations goals2.T F T F TUnit 6PART 1Listening I1. BCDB2. TFFFTFLstening II1.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACALisening III1.CABD2.1.crowding war water grass2.what is happening keep the number of horses low3.target practice where the horses were found4.gotten rid of stayListening IV1. FTFTFTFF2. 1×2×3×4√ 5× 6 √PART 21.DABCCA2.1.farm animals hold feed2.small pets toys3.bury toss them out4. real shame5.dangerous destructive bring diseases6.have a point7.humanely limit8.time money warm place9.isolated company10.storm of debatePART 31.ADDBACAB2.1. female collectively2. not a moment3.infinite care4.picks up keft to right5.stuck smarter6.salt water lake dock7.self-aware non-human intelligence belong in captivityPART 4Listening 11.1√ 2×3×4√ 5√ 6√ 7 √ 82.ACCADLstening II1. CBDDA2. 1×2√ 3×4×5√ 6×7√ 8×Lstening III1CADBB2.1.family holiday2.7-foot 18 stones3.stroking adjusting his clothing4.fractured skull black eye broken arm5.lose his love6.cat7.get-well cards presentsLisrening IV1.1)a.whales and dolphinsb.birdsc. tigers2)a. meat oilb.handbags shoesc.furd.ivory2.TFTT。
Unit 9Part OneAlice: Listen! The sound of that music! It...it's fascinating! Where...where is it from?Xiao Hong: Oh, I...I don't know actually.Henry: Over there! Shall we go take a closer look?Alice & Xiao Hong: OK.Xiao Hong: Oh, it's a kind of Chinese folk instrument called pipa.Alice: Wow, what a beautiful musical instrument!Xiao Hong: Sure.Henry: What's more, it makes such a marvelous sound!Xiao Hong: Oh, I'm glad to hear you say that. Actually, our folk instruments are quite unique. You know, the sound is beautiful and, as you see, it looks good. But, still, unfortunately, they are getting less popular these days.Alice: Really? That's incredible. You know, our Scottish bagpipes, which are some of the oldest instruments in the world, are still quite popular.Xiao Hong: Well, I'm afraid it's not the case in our country. Y ou know, I'm not exaggerating. Nowadays the vast majority of young people prefer western music to Chinese folk music, and they think Chinese folk music and classical instruments are old-fashioned.Henry: What a pity! Many people listen to bagpipes and they are heard on all kinds of different occasions. I wonder why Chinese folk instruments, as old as those bagpipes, are so little appreciated today.Xiao Hong: Well, I think historic reasons may partly account for it. You know, in ancient times, most of the Chinese folk instruments were used to please and entertain the nobles. You know, they were too expensive for ordinary people to own and play unless the poor played them in the street to earn a living.Alice: I know that some Chinese emperors loved music and had a good taste in it.Xiao Hong: Oh, yes, like Tang Xuanzong, but his ministers were firmly opposed to it. They believed that the emperor's attention might be distracted from ruling the country if he spent too much time on music. And they seemed to think of music as something trifling and unimportant. Henry: But things are quite different in our country. Our people are extremely interested in music, and are very proud of our traditions. We view music as part of our lives.Alice: Y eah, and our government spends a lot of money on music education. In the year 1999——2000 for example, the Department of Education spent 1.5 billion dollars on teaching music 1999so that lots of children had the chance to learn to play musical instruments.Xiao Hong: I do wish that more people would appreciate the exquisite melody of our folk instruments and be proud of our traditions.Henry: What's the difference between western music and Chinese music?Xiao Hong: Well, young people think that western music is more exciting and passionate. The rhythm is stronger, which makes them feel more excited. Well, on the other hand, the Chinese music is harmonious, soft, gentle, mild and calm. It helps make people feel peaceful, comfortable and relaxed.Alice: Y es, there are differences between Chinese music and...and western music, but one isn't really better than the other.Xiao Hong: No, no, no. Absolutely not. When I listen to Chinese music, the beautiful melodyalways reminds me of the beauty of nature, hills, streams, small bridges and the singing of birds. You know, the melody is like the music of the nightingale, the music of running water and etc. But western music is more upbeat and exciting. I get full of energy and I want to dance and sing with it. I like rock music better than folk music actually.Henry: Rock and roll has a long history in western countries. There are plenty of bands playing different kinds of rock and roll music, like heavy metal and punk.Xiao Hong: And most of our Chinese musical instruments are made of wood, bamboo or something like that, so the music sounds natural while yours nowadays are mostly made of metal and they seem to be much more complex.Alice: Right. Take our flutes for example. They have more holes and buttons, so they rely on very precise notes to produce music.Xiao Hong: What's more, western singers are usually good at dancing while they sing, but our singers are usually only good at singing.Henry: I suppose because of cultural differences, Chinese, like their music, are usually more reserved.Xiao Hong: There are still some people who prefer Chinese folk music. The pop music nowadaysis increasingly dominated by western music.Alice: I guess people are immediately attracted to western music, but Chinese music has the mysterious power to attract you without you realizing it.Xiao Hong: Y eah, Chinese traditional culture has made a deep impact on Chinese music. Y ou know, the music emphasizes people's feelings and is very emotional.Alice: I've heard that the structure of western music is more logical than that of Chinese music.Xiao Hong: I find that the lyrics are different too. Chinese people tend to express their emotions indirectly while western people are more direct and individualistic. They make full use of music and instruments to express their personal feelings, such as excitement, disappointment, love, sorrow and etc.Henry: Western music has absorbed many musical elements from African music. It places great importance on rhythm, such as heavy metal music, rock music, hip hop and so on.Alice: Yes, and, of course, we have a number of well-known composers these days.Henry: Mm, nowadays it seems that rock and pop music dominate the musical world. In many pieces of music, one instrument can be used in order to produce a distinct sense of perception.Xiao Hong: I guess, eventually, because of globalization, the differences between western music and Chinese music may become less noticeable. You know, in the future, the music may have a lot more in common than we have realized now.Alice: Oh, as far as pop music is concerned, what you say is probably true, but even though musicis a universal language, folk music shouldn't be changed.Xiao Hong: That's right. Don't you think it would be a good idea to buy some Chinese folk music CDs to take home with you?Alice & Henry: That's a good idea! Let's go to the CD shop.Exercise 21.C2.C3.C 4,W 5,W 6.C 7.C 8.C 9.C 10,W 11.W 12.W 13.C 14.W 15.W 16.C 17.W 18.WExercise 31.perfer old-fashioned2.as old as3.account for4.own play earn to living5.very proud of6.1.5 billion had the chance7.hillls small bridges singing of birds8.full of energy9.holes buttons precise notes 10.indirectly individualistic 11.places great importance12.a universal languagePartTwo Listening I(Bill, Howard, and Lisa are talking about background music.)Part IBill: What are you working on now?Howard: I've just finished a piece of background music.Lisa: Background music? Oh, like the music they're playing here now. Howard: Yes. You hear it everywhere, in restaurants, airports, supermarkets, department stores... Bill: In banks, too. I noticed it while we were at the bank today.Lisa: Did you? I didn't.Howard: Y ou are not supposed to notice it. It's just there, in the background. It's supposed to influence your attitudes, and put you in the right mood.Lisa: I'm not sure I like that idea.Howard: Well, it seems to work. Companies pay millions of dollars every year for background music. It's supposed to give you a better feeling about yourself and the people around you. Factories use it a lot. It makes the workers happy, and they work better that way. In one factory, music increased production by 4.5 percent.Bill: I should think they'd get tired of hearing music all day.Howard: They don't though. One fellow in San Francisco told me, "If the music stops, somebody always runs to the telephone to complain."Lisa: Now that I think about it, I can't remember when there wasn't background music in restaurants and stores.Howard: That shows how young you are. Actually, it all started during World War II when some factories had their own orchestras to keep workers happy and calm. Now, of course, the music is piped in by a machine, and different kinds of music are played at different times during the day. They play faster music at 10 in the morning than at 8, for instance, because workers tend to be slower then.Part IIBill: What about restaurants? Do they play the same music for dinner and lunch?Howard: I don't know about that, but I do know that hamburger places play fast music. When they started playing faster music, they found that a customer spent only seventeen minutes eating. The time was 22 minutes before that.Lisa: So they have more people coming in and out to buy hamburgers.Howard: Exactly. And that's good for business. You can see why music has become so popular. In Los Angeles, for instance, 30 different companies are selling background music services. Lisa: I still think there's something about it that I don't quite like.Howard: I know what you mean, but lots of people wouldn't agree with you. The Xerox Corporation in Rochester, N. Y Corporation in Rochester, N. Y., spends more than $80,000 a year for background music. Prisons ., spends more than $80,000 a year for background music. Prisons use it, and farmers use it to keep their cattle calm. It's even supposed to have an effect on plants.Exercise 11.restaurants airports supermarkets 12,attitudes in the right mood the people around him happy work better 3.World War II happy calm a machine kinds of music different times faster slowerExercise 21.T2.F3.F4.T5.T6.F7.T8.FListening IIMore and more doctors are operating to music. They say it eases their minds.One doctor in Chicago says classical music is the only kind that does not interfere while he is operating. But in another Chicago operating room, the British rock group Pink Floyd can be heard. And in Washington, at least one doctor operates to the sound of the Beatles.Researchers from the State University of New Y ork at Buffalo did a study that seems to confirm that music helps reduce tension in doctors. They gave fifty male doctors difficult mathematical kinds of tests.The doctors did the test while listening to music they themselves had chosen. They did a similar test while listening to music that was chosen for them. They were tested a third time with no music at all. Each time, a machine measured their heart rate and blood pressure.The doctors worked most quickly and calmly when listening to the music they themselves had chosen. They did the worst with no music at all.What kinds of music did the doctors choose? Mostly classical. But some chose instrumental jazz pieces or Irish folk music.There probably is one piece of music that should never be played during an operation: Brahms' "Lullaby". You do not want your doctor to go to sleep while operating, do you? Exercise 11.eases their minds operations2.classical instrumental jazz folk music3.A reduce tension B. 50/fifty male doctors C. Mathematics D.1)quickly 2)calmly 3)chosen for them 4)No music 5)the worst E. sleepyExercise 21.T2.F3.T4.F5.FPart ThreePractice OneThe Beatles were probably the most important pop and rock group of all time. They were together for only eight years, but their influence has lasted much longer.The Beatles came from Liverpool, England. They started playing together in 1962, although Paul McCartney and John Lennon played together in another group. They started by playing rock'n' roll songs, but they quickly developed their own style. By 1963, they had become Britain's top rock group. A year later they toured the United States, where they attracted millions of fans.By the time the Beatles broke up in 1970, they had changed the nature of rock and pop music. They introduced new sounds and rhythms, and they experimented with different types of musical instruments. They recorded hundreds of songs and they sold millions and millions of records. They made many films and won many awards for their music.Today, the Beatles' songs are still very famous all over the world.Exercise 1B D A CExercise 21.their own style2.the nature3.sounds experimented4.songs records5.films awardsPractice Two(Dennis is interviewing Stephanie, a music teacher.)Dennis: Which do you think is the easiest instrument for people to learn to play?Stephanie: It's difficult to answer that question because learning to play an instrument is one thing, and learning to play it well is another. But I think the guitar is the easiest to learn. It's one of the easiest to carry, and that's important for a musician.Dennis: And the second?Stephanie: My second choice is probably the most popular instrument, and I think it's the most satisfying, too, because you can make more progress at the beginning. That's the piano.Dennis: So you think playing the piano's more difficult than playing the guitar.Stephanie: Yes, because, well, your left hand has to work as hard as your right and both hands have to make notes. With the guitar, you make the notes with the left hand, and the right just picksthe strings.Dennis: Is playing a woodwind or brass instrument very difficult? It looks quite easy.Stephanie: I think the clarinet and the trumpet are the easiest to learn. Finding the notes is quite easy and breathing isn't a serious problem. But I find all the wind instruments less satisfying for people to play, because you can't do much alone. You have to play with others.Dennis: And which do you think is the most difficult instrument to play?Stephanie: No doubt at all, the violin. And I think it's the most difficult because both hands have to work, but they have to do different jobs. I mean, the left hand makes the notes on the strings, andit's harder to find the notes than on the guitar because the strings are shorter. The right hand has to manage the bow, and bowing well is an art. Finally, the most difficult thing about it, I find, is holding the instrument under your chin. It's not a natural position to adopt.Exercise 11.(1)trumpet (2)piano (3)violin 2(2)piano (1)clarinetExercise 21.picks the strings2.as hard as3.makes the notes4.on the strings5.manages the bowExercise 31.learn2.carry3.popular4.satisfying5.progress6.easiest7.less satisfying8.most difficultPractice Three(Four people, Steve, Connie, Diane, and Martin, are giving their opinions about their favorite musicians before attending an international concert.)Steve: Oh, no doubt about it. My favorite's Bruce Springsteen. He's the best there is. I think he's more direct, he communicates better than the others. It's not that the others are bad, but he's better.In a way his kind of rock music's more old-fashioned than, er, Sting's, say, but for me it's moreexciting. And the messages in his songs are simpler. They're easier to understand than Sting's or Peter Gabriel's, so I can relate to them better.Connie: The singer I want to hear most is Peter Gabriel. He's not really one of my favorite singerssingers——I mean I don't think he's as exciting as Bruce Springsteen, for instance—but his latest songs, these African songs with African rhythms, well, they're more musical than pop songs usually are. And I think all the singers are sincere about the human rights movement, but he feels more deeply about it than the others.Diane: Oh, I think Sting and his band are the best. Sting's better now with his new band than during his time with the Police. He seems more natural and I think he enjoys playing more. And he's a much better songwriter now. The one I like most in the band is the sax-player, Branford Marsalis. He plays brilliantly, but the best thing about him is his sense of humor. He really makes me laugh!Martin: To tell you the truth, I'm looking forward most to hearing Youssou N'Dour. I like Peter Gabriel's African songs, but he's an Englishman, not an African, so it's not the same as the real thing. I mean, real African music is different from reggae and rock, because it's more rhythmic than reggae, but not as heavy as rock. The rhythms are very unusual, too, and more sophisticated than people think.Exercise 11.T 2,T 3,T 4.F 5.F 6.F 7.F 8.TExercise 2Musicians BruceSpringsteen Sting PeterGabrielBranfordMarsalisYoussouN’Dourbrilliant √ communicative √direct √exciting √musical √natural √Not so heavy √ humorous √rhythmic √ simpler √ sophisticated √ unusual √Practice FourIt has long been known that Cellist Yo-Yo Ma possesses astonishing musical talent. By age seven he had already played for Isaac Stern and Pablo Casals. Later he went to Juilliard and on to Harvard, where he studied international cultures. Soon he tasted stardom, giving concerts around the world.But he tells of a humbling experience while in Namibia, where he went to observe trance dances and musical rituals of the people. At the end of his stay he produced a cello and offered them a performance of his own. "They said, 'Stop. Don't play. We want to play for you, '" Ma remembers with a laugh. "I think I was too self-important to bring my cello. They didn't give adamn."His story is one of a star realizing that not everyone knows or cares who he is. "To be a good performer, you have to have a very strong ego," he says. "But to be a really good performer, you have to make sure that your ego is not the center. To play Beethoven, you have to figure out who he was, and how that's encoded in the music. And then you have to realize you are not Beethoven."Exercise 11.A2.B3.A4.C5.AExercise 21.T2.N3.T4.F5.TPart FourSection 1Some people called John Lennon the "thinking man's Beatle". He was serious and creative, and many young people of the 1960s and 1970s thought he spoke for them.Lennon was born on October 9,1940, in Liverpool, England. During his childhood he listened to the music of rock 'n' roll singers like Elvis Presley, Jerry Lee Lewis, and Little Richard. At 15, when he was in an art school, Lennon started his first band, the Quarrymen. The band included Paul McCartney, George Harrison, and Pete Best, a drummer.The Quarrymen later changed their name to the Silver Beatles and then the Beatles. Ringo Starr replaced Pete Best as drummer. Between 1958 and 1962 the group played in nightclubs in Liverpool and Hamburg, West Germany. Then the Beatles made a record called "I Wanna Hold Your Hand" and changed the history of rock 'n' roll.Many people think that Lennon was the most important singer and songwriter of the Beatles. In general, his songs are sensitive and intelligent, and they still influence today's popular musicians.On December 8, 1980, a confused young man shot John Lennon outside his apartment building in New York City. A few days later, thousands of people gathered in New York's Central Park to remember him. For them, and for many other people in the world, he was someone very special.1.T2.F3.F4.T5.F6.T7.T8.TSection IIRock began in the U.S.A. in the early 1950s. At that time, "rhythm and blues" music was very popular with black Americans. "R&B" was a mixture of black religious music and jazz. It had strong rhythms that you could dance to and simple, fast lyrics.Noticing the success of R&B music, white musicians started to copy the same style. By the mid 1950s, this new white R&B music, called "rock 'n' roll", had become very popular. Singers like Elvis Presley and Bill Haley attracted millions of teenage fans. Their music was fast and loud. Many older people thought that rock 'n' roll was very dangerous.Rock music has continued to change and develop. It has combined with music from different parts of the world. Today, there are hundreds of different types of rock music, and almost every country has its own form of rock. There are "heavy metal" which is extremely loud with hard rhythms, "reggae" from Jamaica that combines rock with jazz and Latin rhythms, "rap" that hasdeveloped on the streets of New York, "disco", a type of soft rock music for dancing, "Afro-rock" that combines rock with African rhythms, "Mex-rock", which combines rock with traditional Mexican melodies...and many, many more.1 2√ 3 4√ 5 6 7√ 8√ 9 10√ 11 12√Section IIIBig Big Worldby Emilia*I'm a big big girl in a big big worldIt's not a big big thing if you leave meBut I do do feel that I do do will miss you muchMiss you muchI can see the first leaf fallingIt's all yellow and niceIt's so very cold outsideLike the way I'm feeling inside(Repeat the part marked with "*".)Outside it's now rainingAnd tears are falling from my eyesWhy did it have to happenWhy did it all have to end(Repeat the part marked with "*".)I have your arms around meWarm like fireBut when I open my eyes, you're gone(Repeat the part marked with "*".)I'm a big big girl in a big big worldIt's not a big big thing if you leave meBut I do feel I will miss you muchMiss you much1.falling2.nice3.cold4.inside5.raining6.tears7.happen8.arms9.fire 10,gone。
新编大学英语视听说book3Unit4听力答案及文本1Unit 4Part OneListening IFor many of you this will be your last year at university and now is the time for you to begin thinking seriously about your future careers. In order to give you as much help as possible, I have quoted a list of questions that you ought to ask yourself.First, "Have I got a clear knowledge of my abilities as well as my interests?" Be honest about your weaknesses as well as your strengths. Take a really good look at yourself and give real thought to the kind of person you are, and what kind of person you want to be.Second, "Do I know the kinds of occupations in which people like myself tend to find success and satisfaction?" Talk to people who have similar abilities and interests and who are already in the careers that interest you. You can gain some idea of what they consider to be important and challenging in those careers. Watch these people at work.Third, "Have I weighed carefully the immediate advantages against the long-term prospects offered by the jobs I am considering?" Will the occupation you select give you satisfaction in the years to come? Realize now the importance of education in all fields, technical and professional. Remember that chances of promotion are usually given to educated persons—other things being equal.Fourth, "Have I talked with my parents, my teachers and my headmaster?" Remember they have a lot of experience that you can benefit from. They can help you think about the jobs. Theycan stimulate you to give careful thought to what you really want to do, and offer useful suggestions about how you might take full advantage of your personal qualities and qualifications.Last, "How do I regard my job? Is it just a means of getting money to do the things that I want to do? Is the work important to my future happiness? Is it a combination of both?"The above questions and their answers should give you some better ideas about how you should start planning your career. Your life-long job cannot be approached in any kind of haphazard fashion. It must be considered carefully, examined from every angle, and talked over with those who know you and those who can help you in any way.Exercise 12、4、5、6、8Exercise 21. weaknesses2. similar abilities and interests / interest you/ important and challenging3. education/ promotion/ educated persons4. parents/ teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II(Here's a dialog between a woman whose job is to help people find jobs and a man looking for a job.)Woman: Look. Here's a job that might interest you.Man: What is it? Are you sure? The last job interview you sent me off to was a disaster.Woman: Well, look. It says they want a sales manager, and it looks like it's a big international company. That'd be good. Youmight get to travel.Man: What kind of company is it, though?Woman: Um, let's see. Yes, it's a textile company that seems to import from abroad. They say the salary is really good. They operate a system of paying you a basic salary and then offering you a sales commission on top of that. They say it is high. And oh, look! They give you a car to travel round in. That's not bad, is it?Man: Um, do they say anything about experience?Woman: Um, let's see. No, they want someone young with ambition and enthusiasm. Oh yes, they want graduates, so that's OK. You've been to university. Now what else? Let's see.Man: There must be some catch.Woman: No, the only thing is you have to travel, but then that's what the company car's for. Oh, and you have to be able to get on well with other people because it says you have to be good on a team.Man: Um, perhaps I'll have a closer look at that one.Exercise 11. D2. D3. A4. BExercise 21. import from abroad2. sales manager3. salary4. sales commission5. travel in6. experience7. university8. on a teamListening IIIInterviewer: Some people feel that their jobs are misunderstood by others. Is that very common?Sociologist: Oh, absolutely. Most jobs or professions have an image or stereotype attached to them, and some of these are not realistic. The serious point is that young people choose their careers based on these false images, and they may even avoid certain careers which have a negative image. This can cause problems for the economy.Interviewer: Is there evidence of this problem?Sociologist: Yes, there was a recent survey of children's attitudes to different professions.Interviewer: How was this done? Children don't know much about jobs and professions.Sociologist: True. What the investigators wanted to get was children's impressions and prejudices. They gave the children twelve pairs of statements, one of the pair positive, and the other negative. Children were asked to say which of the statements was "most true" for each profession.Interviewer: For example?Sociologist: Well, for example, "Such and such a person is likely to be boring or interesting company."Interviewer: I see. What professions did they ask about?Sociologist: The list is long, but it included lawyers, economists, accountants, sales representatives, scientists and engineers.Interviewer: And the results?Sociologist: Well, they are striking, especially for engineerswho came out much worse than one might expect. About 90 percent of the children thought that engineering was a "dirty job", of "low status", and the engineer was more likely to take orders than to give them. The only other person they thought more likely to lose his job was the sales representative. But, there were good points too. Engineering was seen to be "interesting, well-paid work".Interviewer: Hmm, not a rosy picture.Sociologist: No, but it got better when children were asked what they thought of the engineer as a person. Most of them chose positive comments, but most thought the engineer was likely to be badly dressed.Interviewer: What about other professions? What were the most popular?Sociologist: Oh, the lawyers by far. Next came accountants and scientists as well as economists. The engineers and sales representatives were the least popular.Interviewer: Sounds like a sign of the times.Sociologist: Yes, but I think the most serious implication was the children's apparent ignorance of the importance of the engineer's role in society.Exercise 11. choose their careers2. avoid certain careers3.different professions4. impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. F3. T4. F5. TListening IVMegan: Tim, if you could pick any occupation in the world, what do you think would be a cool one?Tim: Well, truth be told, i think it would be pretty awesome to be a commercial fisherman. Megan: Fisherman! Why would you want to be a fisherman?Tim: Believe it or not, i’m really fascinated by the ocean. I like spending time in the ocean and I think if you go out on those boats and get away from the land, you really get in touch with the sea.Megan: Is it dangerous, though?Tim: Oh, it can be dangerous, for sure. You can get caught in storms. It can be rough sometimes.Megan: Do you get paid a lot of money?Tim: Not so much, but that is not necessarily vital. You know, you can work with nature. You can catch healthful food, provide for yourself, and I think that’s really fulfilling. How about you , Megan? What do you think would be a cool job?Megan: I think I would like to be a writer.Tim: Why is t hat? Lots of writers don’t succeed in making much of a living.Megan:Well, being a movie star would be exciting too, or a rock star, but the fame is overwhelming—too many peoplealways want to talk to you or want your autograph. I think as a writer, you are doing something you love without all that pressure or the media coming after you, and you can sort of make your own workk schedule and do it where you like. You can write in the countryside in a cabin, or you can write in the city wherever you please. So, I think it is a very flexible, rewarding job.Tim: Yeah, you’ve got to have the aptitude for it, though. Do you think you have what it takes?Megan: No, not yet. I’m a terrible writer. But anyway, if I could have my pick of jobs, I’d like to be a writer.Exercise 11. C2. A3. C4. B5. DExercise 21. occupation, cool2. catch, provide, fulfilling3. media coming after you, making your own work schedule4. have my pick of jobsPart 4Further ListeningListening IThere are at least 100 million workers in the Unites States. Most of them are on the job 35 to 40 hours a week. Their typical day includes seven to eight hours of work. Usually, they have a 15-minute coffee break in the morning and in the afternoon. But work schedules vary from job to job.White-collar workers—office workers and manyprofessionals—usually have "nine to five" jobs. They begin at 9:00 a.m. and finish at 5:00 p.m. Monday through Friday. "Blue-collar" workers—mechanics, electricians, and laborers—often work from 8:00 a.m. to 4:00 p.m. In many factories, blue-collar workers come to work in eight-hour shifts. Typically, these shifts start at 8:00 a.m., 4:00 p.m., and midnight. Finally, sales people and managers in retail stores work on Monday and Thursday nights, when the stores are open. Many retail workers also work on Saturdays, and some work on Sundays.These are the normal schedules for most American workers. However, many businesses now use a new system called "flex-time scheduling". Under this system, the employees choose their own working hours. Some people work from 8:00 to 4:00 five days a week. Some work from 9:00 to 5:00. Other people work 10 or 12 hours a day four days a week. Employees and managers are both happy with the system. The employees like the freedom of choice, so they work hard. The managers, of course, like the hard-working employees.What, then, is a typical work schedule? It depends on the job—and on the workers.Exercise:1. 100 million2. 35 to 403. 7 to 84. office workers, many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday ,Thursday, Saturdays ,Sundays8.choose their own working hours, freedom of choice , happy withListening IIMan: How long have you worked for AM-ADMEL, Gill?Woman: Only for a year. It's May now, isn't it? Yes, I joined last August in fact.Man: August in 1996.Woman: Yes.Man: What did you do before that?Woman: I used to work for a travel agency in London.Man: It was interesting, wasn't it?Woman: Not really. It was just secretarial work, rather like this job. And it wasn't too well-paid. But I took a secretarial course when I left school and I couldn't think what else to do.Man: So you went straight from school into a secretarial course, didn't you?Woman: Well, not quite. I left school when I was 16, in 1989, I think it was. And then I went to work in a hotel in Austria for a year, to learn some German.Man: Austria? Why Austria?Woman: I don't know really. Well, we used to go there on holiday quite often when we were younger, and, well, I like Austria actually. Anyway then I went back and did the secretarial course. That was a year's course.Man: And then you got the job at the travel agency I suppose.Woman: Yeah, that's right. That was in 1991.Man: So you were there for five years!Woman: Yes, it's awful, isn't it? Actually, I'm thinking of giving it all up to become a nurse.Man: Really?Woman: Well, I worked in a hospital in Twickenham during my last year at school. Just cleaning and helping to make bedsand so on. It was part of our Practical Careers training.Man: And you liked it?Woman: Yes, it was interesting.Exercise1. A2. D3. C4. A5. DListening IIIMan: Well, now then, one thing I'd like to ask is, er, exactly why you applied for the job. I mean, just looking at your application form, you're actually over-qualified...Woman: Yes, I thought you might ask that. Um, the thing is, in my present job, although I'm actually in charge of a small team and I have a lot of responsibility, it's largely a desk job with a lot of paperwork...Man: And you're not too keen on being stuck in an office all day?Woman: To be honest, no, I'm not. I much prefer being out on site where I can supervise things, and deal with problems as they occur. And this job should give me the kind of contact with other engineers, architects, builders and so on.Man: Mmm. You'd certainly have to do quite a lot of traveling in the local area, you know, visiting different sites. You do realize, though, that the starting salary isn't as good as the salary in your present job?Woman: Yes, I realize that, but um, it does say in the job advertisement that the promotion prospects are very good.Man: That's true, and er, as this is a new project that we'reworking on, we think there'll be a very good chance of fairly quick promotion, depending on performance, that is...Woman: Yes, of course. Well, you see, I've got very little chance of promotion in my present job.I mean it's a very small company and there's nowhere really for me to go; that's why I'm looking around for somewhere else.Exercise1. C2. B3. D4. C5. AListening IVDavid: Hi! You're listening to Radio Southwest, the best in the southwest for music andup-to-the-minute news. Sue's here. Hello, Sue.Sue: Hello, David.David: And we've got the Jobspot for you today. So, if you're looking for a new job, this could be the spot for you. So, let's have a look, and see what we've got today.Sue: Well, the first one we've got is a cook. That's in a large, busy restaurant, so it's very useful to have had experience in cooking. Must be a high school graduate and the pay is $12 an hour. So that's not bad, is it? The hours are good too. That's Monday to Friday, 3:00 p.m. till 6:00 p.m.David: Great. Thanks, Sue. So that's a cook. Now, how do you fancy working out of doors? How do you fancy being a gardener? So as long as you're fit and strong, and at least 16 years old, that'll suit you. The pay is $8 an hour. And the hours, Tuesday to Saturday, 8:30 a.m. to 5:00 p.m., you have to work on Sundayonce a month, but on Monday the Garden Center's closed. Now, the sort of work you'd be doing is potting, watering, things like that. So, how about applying for that? Pay, $8 an hour. Sue, what else have you got?Sue: Right, Dave. Well, from outdoors to indoors. We've got a word processor operator job here. This job might suit a woman with school-age children, because the hours are only 15 hours a week. It's a small, friendly office, and they require a high school graduate with two years' experience operating a computer. Pay is $9 per hour. So, there you go. That's a nice job in an office. If you fancy any of those jobs, give us a ring here on Jobspot at Radio Southwest. And now back to the music.Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACE。
新编大学英语视听说 book3 Unit 6听力答案与文本1Unit 6Part 1Listening IWoman: Why do you think people are afraid of tarantulasMan: Well, I guess it's because people are afraid of all spiders, and tarantulas happen to be the biggest of all the spiders. And maybe it's also because some spiders really are very poisonous. In California, for example—in most of the garages in California—you get black widows, which are quite small but certainly more dangerous than tarantulas. Woman: But personally you aren't afraid of tarantulasMan: Well, I shouldn't be frightened of tarantulas, simply because I know that they aren't really dangerous —all they can do is give you a small bite, but it's not poisonous. And yet I must say I don't like to pick them up. But you see, some people keep pet mice and pet rabbits and, well, they can give you a much worse bitethan a tarantula ever could. And yet people aren't frightened of them.Woman: Why do you think people are frightened of spidersMan: I don't know—it's very strange. People are frightened of spiders and they are frightened of snakes, and, well, obviously some spiders and some snakes really are poisonous. But most snakes are harmless, and it's really strange that people are so frightened of spiders because it's quite difficult to find a spider that's really dangerous.Exercise 11. B2. C3. D4. B Exercise 21. T2. F3. F4. FListening IIShop Assistant: Good afternoon, madam. Can I help youCustomer: Yes. I'm looking for a pet for my son. Can you suggest anythingShop Assistant: What kind of pet does he want A traditional pet, a cat...or a dog Or something unusual Customer: Well, he'd like a snake or a crocodile,but he isn't going to get one. Shop Assistant: We've got a nice Alsatian at the moment.Customer: An Alsatian Did you say \They're very big and savage.Shop Assistant: Oh, no, madam. They aren't as savage as some dogs. Customer: ReallyShop Assistant: Oh, yes. Last week we had a small dog. It was only as big as your handbag, but it was as savage as a tiger—it bit me three times! Customer: Perhaps not a dog, then. Shop Assistant: How about a catCustomer: A cat Hmm...they aren't as friendly as dogs, are theyShop Assistant: No, but they don't eat as much as dogs either. And they're very clean. They wash themselves every day. Customer: Hmm...Shop Assistant: Or how about a bird A parrot or a budgie We have both. Customer: Which do you rexxmend Shop Assistant: Well, budgies aren't as easy to train and they never speak as well as parrots. Customer: Yes, but budgies don't need as much space as parrots, do theyShop Assistant: That's true. Budgies are very popular because they are so easy to keep. Customer: Yes...but they're a bit noisy, aren't they I want a quiet pet.Shop Assistant: A quiet pet Well, how about a goldfish There's nothing as quiet as a goldfish.Exercise 11. snake, crocodile2. parrot, budgie3. quiet4. goldfish Exercise 21. A2. D3. A4. C5. AListening IIIOver 450 wild horses have been killed in Nevada. The land they were on belonged to thegovernment. Some people say it is worse than when all the buffaloes were killed. Many of the horses were shot while running.Wild horses are protected by law. 28 thousand wild horses share the land with six million cattle. Cattlemen say the horses are crowding the cattle out. It is said that there is a war going on. Both the cattle and the horses need the water and grass that is on the land.The president of the Nevada cattleman group also helps to protect the horses. He says that he does not like what is happening to the horses. He does want the government to help keep the number of horses low.Some people think the Navy used the wild horses for target practice. Pilots flew over the area where the horses were found. The Navy said that they did not let their pilots do that.The horses were found far from the nearest road. The killings happened over a large area. It has been happening for the last two years.Some people think that the horses should be gotten rid of. Others think that they should stay. In the meantime, the police will try to figure out who killed the horses. Questions:animal has been killed in Nevada recently is the number of the animals killed long has the killing lasted did the killingExercise 11. C2. A3. BExercise 21. crowding , war, water, grass2. what ishappening, keep the number of horses low 3. target practice, where the horses were found 4. gotten rid of , stayListening IVNarrator: I'm going to tell you about an extraordinary thing that happened the day before yesterday, about eight o'clock at night, a young woman approached the box office of the best movie theater in the city. She had with her an enormous dog with a beautifully groomed coat. She bought two tickets and went toward the door, followed by her dog. The manager of the theater spoke to her...Manager: I'm sorry, Miss, but dogs aren't allowed in this theater. Girl: But I have a ticket for him.Manager: I'm very sorry, but animals aren't permitted.Girl: You don't understand. This is a special case. My dog is so well trained and so intelligent that he's almost human.Manager: I see that you have an exceptional animal, but...Girl: I promise you that if there is any problemwe'll leave the theater immediately. I assure you that this dog isn't like any other dog you've ever seen.Manager: Well, all right. I'll let you go in, since the theater is almost empty tonight. Nevertheless, your dog will have to behave himself, or you will have to leave.Narrator: About two hours later, and now the people are leaving the theater. The manager sees the girl with her dog.Manager: I congratulate you. You are right; your dog behaved very well. I've been watching him, and it's amazing how quiet he was.Girl: I told you that he's well trained and very intelligent.Manager: He certainly is. It even seemed as if he was enjoying the movie.Girl: Oh, he did enjoy it. He liked the film very much. However, he liked the book much better. Exercise 11. F2. T3. F4. T 8. F Exercise 2 4 6Part 2Exercise 11. D2. A3. B4. C5. C6. A Exercise 21. farm animals, hold, feed2. small pets, toys3. bury, toss them out4. real shame5. dangerous, destructive, bring diseases6. havea point 7. humanely, limit8. time, money, warm place 9. isolated, xxpany 10. storm of debatePart 3Exercise 11. A2. D3. D4. B5. A6. C7. A8. B Exercise 21. female, collectively2. not a moment3. infinite care up, left to right 5. struck, smarter 6. salt water lake, dock 7. self-aware, non-human intelligence, belong in captivityPart 4Further listening Listening 1Many people around the world bexxe friends with animals. Some call their pet animals byhuman names. They treat them like members of thefamily. Scientists now are proving what many pet owners already know—pets are good for your health.The Delta Society is a research center in the northwestern state of Washington. They say animals have a healthy effect on people, especially people who are sick and lonely.Several years ago, the Delta Society developed a program called \people work in pet therapy programs throughout the country. They take animals to visit people in hospitals, prisons and private homes. Dogs and cats are taken most often. But other visitors include snakes, rabbits, horses and birds. Some of the animals stay with the people forever. The dolphin also has a good effect on people. Scientists at the Dolphin Research Center in Florida introduce sick people to playful dolphins. People feed the dolphins, touch them, and ride on the dolphins' backs in the water. In this way, the animals help the patients feel better.The head of the Delta Society, Linda Hines, says one reason for the pet therapy is that animals help sick people get better. Also, she says the animals have a calming effect on people, because pets can help peopleforget their own problems.Exercise 1 1. Exercise 21. A2. C3. C4. AListening II1Unit 6Part 1Listening IWoman: Why do you think people are afraid of tarantulasMan: Well, I guess it's because people are afraid of all spiders, and tarantulas happen to be the biggest of all the spiders. And maybe it's also because some spiders really are very poisonous. In California, for example—in most of the garages in California—you get black widows, which are quite small but certainly more dangerous than tarantulas. Woman: But personally you aren't afraid of tarantulasMan: Well, I shouldn't be frightened of tarantulas, simply because I know that they aren't really dangerous —all they can do is give you a small bite, but it's not poisonous. And yet I must say I don't like to pick them up. But you see, some people keep pet mice and petrabbits and, well, they can give you a much worse bite than a tarantula ever could. And yet people aren't frightened of them.Woman: Why do you think people are frightened of spidersMan: I don't know—it's very strange. People are frightened of spiders and they are frightened of snakes, and, well, obviously some spiders and some snakes really are poisonous. But most snakes are harmless, and it's really strange that people are so frightened of spiders because it's quite difficult to find a spider that's really dangerous.Exercise 11. B2. C3. D4. B Exercise 21. T2. F3. F4. FListening IIShop Assistant: Good afternoon, madam. Can I help youCustomer: Yes. I'm looking for a pet for my son. Can you suggest anythingShop Assistant: What kind of pet does he want A traditional pet, a cat...or a dog Or something unusualCustomer: Well, he'd like a snake or a crocodile, but he isn't going to get one. Shop Assistant: We've got a nice Alsatian at the moment.Customer: An Alsatian Did you say \They're very big and savage.Shop Assistant: Oh, no, madam. They aren't as savage as some dogs. Customer: ReallyShop Assistant: Oh, yes. Last week we had a small dog. It was only as big as your handbag, but it was as savage as a tiger—it bit me three times! Customer: Perhaps not a dog, then. Shop Assistant: How about a catCustomer: A cat Hmm...they aren't as friendly as dogs, are theyShop Assistant: No, but they don't eat as much as dogs either. And they're very clean. They wash themselves every day. Customer: Hmm...Shop Assistant: Or how about a bird A parrot or a budgie We have both. Customer: Which do you rexxmend Shop Assistant: Well, budgies aren't as easy to train and they never speak as well as parrots. Customer: Yes, but budgies don't need as much space asparrots, do theyShop Assistant: That's true. Budgies are very popular because they are so easy to keep. Customer: Yes...but they're a bit noisy, aren't they I want a quiet pet.Shop Assistant: A quiet pet Well, how about a goldfish There's nothing as quiet as a goldfish.Exercise 11. snake, crocodile2. parrot, budgie3. quiet4. goldfish Exercise 21. A2. D3. A4. C5. AListening IIIOver 450 wild horses have been killed in Nevada. The land they were on belonged to thegovernment. Some people say it is worse than when all the buffaloes were killed. Many of the horses were shot while running.Wild horses are protected by law. 28 thousand wild horses share the land with six million cattle. Cattlemen say the horses are crowding the cattle out. It is said that there is a war going on. Both the cattle and the horses need the water and grass that is on theland.The president of the Nevada cattleman group also helps to protect the horses. He says that he does not like what is happening to the horses. He does want the government to help keep the number of horses low.Some people think the Navy used the wild horses for target practice. Pilots flew over the area where the horses were found. The Navy said that they did not let their pilots do that.The horses were found far from the nearest road. The killings happened over a large area. It has been happening for the last two years.Some people think that the horses should be gotten rid of. Others think that they should stay. In the meantime, the police will try to figure out who killed the horses. Questions:animal has been killed in Nevada recently is the number of the animals killed long has the killing lasted did the killingExercise 11. C2. A3. BExercise 21. crowding , war, water, grass2. what is happening, keep the number of horses low3. target practice, where the horses were found4. gotten rid of , stayListening IVNarrator: I'm going to tell you about an extraordinary thing that happened the day before yesterday, about eight o'clock at night, a young woman approached the box office of the best movie theater in the city. She had with her an enormous dog with a beautifully groomed coat. She bought two tickets and went toward the door, followed by her dog. The manager of the theater spoke to her...Manager: I'm sorry, Miss, but dogs aren't allowed in this theater. Girl: But I have a ticket for him.Manager: I'm very sorry, but animals aren't permitted.Girl: You don't understand. This is a special case. My dog is so well trained and so intelligent that he's almost human.Manager: I see that you have an exceptional animal, but...Girl: I promise you that if there is any problem we'll leave the theater immediately. I assure you that this dog isn't like any other dog you've ever seen.Manager: Well, all right. I'll let you go in, since the theater is almost empty tonight. Nevertheless, your dog will have to behave himself, or you will have to leave.Narrator: About two hours later, and now the people are leaving the theater. The manager sees the girl with her dog.Manager: I congratulate you. You are right; your dog behaved very well. I've been watching him, and it's amazing how quiet he was.Girl: I told you that he's well trained and very intelligent.Manager: He certainly is. It even seemed as if he was enjoying the movie.Girl: Oh, he did enjoy it. He liked the film very much. However, he liked the book much better. Exercise 11. F2. T3. F4. T 8. F Exercise 2 4 6Part 2Exercise 11. D2. A3. B4. C5. C6. A Exercise 21. farm animals, hold, feed2. small pets, toys3. bury, toss them out4. real shame5. dangerous, destructive, bring diseases6. havea point 7. humanely, limit8. time, money, warm place 9. isolated, xxpany 10. storm of debatePart 3Exercise 11. A2. D3. D4. B5. A6. C7. A8. B Exercise 21. female, collectively2. not a moment3. infinite care up, left to right 5. struck, smarter 6. salt water lake, dock 7. self-aware, non-human intelligence, belong in captivityPart 4Further listening Listening 1Many people around the world bexxe friends with animals. Some call their pet animals byhuman names. They treat them like members of the family. Scientists now are proving what many pet owners already know—pets are good for your health.The Delta Society is a research center in the northwestern state of Washington. They say animals have a healthy effect on people, especially people who are sick and lonely.Several years ago, the Delta Society developed a program called \people work in pet therapy programs throughout the country. They take animals to visit people in hospitals, prisons and private homes. Dogs and cats are taken most often. But other visitors include snakes, rabbits, horses and birds. Some of the animals stay with the people forever. The dolphin also has a good effect on people. Scientists at the Dolphin Research Center in Florida introduce sick people to playful dolphins. People feed the dolphins, touch them, and ride on the dolphins' backs in the water. In this way, the animals help the patients feel better.The head of the Delta Society, Linda Hines, says one reason for the pet therapy is that animals help sick people get better. Also, she says the animals have acalming effect on people, because pets can help people forget their own problems.Exercise 1 1. Exercise 21. A2. C3. C4. AListening II。
Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. BarbaraExercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600 Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5.travel around in 6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign language Practice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice Two(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7.records 8. agree 9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。
Keys to the texts of book3Unit sixPart OneExercise 2 :1. d2. a3. b4.c5. c6. aExercise 31. farm animals; hold; feed2. small pets; toys3. buy; toss them out4. real shame5. dangerous; destructive ; bring diseases6. have a points7. humanely; limit8. time; money; warm place9. isolated; company 10. storm of debatePart TwoListening IExercise 11. b2. c3.d4. bExercise 21 T 2. F 3.F 4. F 5. T 6. TListening IIExercise 11.Her son.2. snake; crocodile3.quiet4.picky/particular Exercise 21. big2. dogs3.tiger4. bit5. cat6. friendly 6. eat 8. clear 9.wash 10.space 11. noisy 12. train 13. speak 14.keep 15. quietPart ThreePractice oneExercise 1(1,4,5,6,7,) yesExercise 21 a 2.b 3.c 4.a 5. dPractice TwoExercise 1(1,3)yesExercise 21. for free2.small donation3. 204. hundreds5. eat little6.50 7. animal shots 8. numerous shots 9. diseasesPractice ThreeExercise 11.c2.b3.d4.c5.aExercise 2(2,5.6.7) yesPractice FourExercise11 c 2.c 3. a 4.b 5. dExercise 21.crowding water; grass;2. what is happening; low3.targetpractice; over the area4. gotten rid of; stayPart Four Testing yourselfSection I1.f2. t3. f4. t5. f6. t7. t 8. f 9. f 10. tSection II1. a2. c3. d4. b5. b6. bSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5000 12. embarrassed 13. advertise the furs 14. export bans 15. importation 16.turtleKeys to the texts of book3Unit sevenPart OneExercise 2 :1. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery ;historic interest3. Summer ; too cold4. long history ; vast territory5. feed the monckys6. as many places as possible.7. you name it8.. host city ;ancient civilization; modern architecture9. city wall; treat yourselves 10.express train Part TwoListening IExercise 11 c 2. b 3. b 4. c 5. d 6. aExercise 21. SN 862 17:50 on July 112. SN863 15:10 on July 14 Listening IIExercise 1(B.C.F.G.H.I) yesExercise 2Part one 1.F 2. T 3.T 4.T Part two 1.F 2.F 3T 4.F Part three1.T2.T3.T .4.T5.FPart ThreePractice oneExercise 1Advantages: ADH ; disadvantages: EExercise 21 c 2.d 3.b 4. cPractice TwoExercise 11. seedypany3.shared4. noisy5. early6. private7. booking8. convenient9. restaurant 10.bathroomsExercise 21. T2. F3. T4. T5.6. TPractice ThreeExercise 11. Fuel2. Water3. Vehicles4. ClothesExercise 21.passing lorries 6. self-sufficient2.enough water 7. car repairs3.drinking 8. cost much4.vehicle 9. sweaters5.emergency 10. European winter Practice FourExercise1a. actress Bb. actress and author A1. a2.b3.b4. a5.b6. a7. a8. b Exercise 21.T . F 3. F 4. F 5. F 6. T 7. F 8.TPart Four Testing yourselfSection I1.F2.T3.T4. T5. FSection II My history teacher1. b2. c3. c4. c5. a6. dSection III1. d2. b3.c4. d5. aKeys to the texts of book3Unit eightPart OneExercise 2 :Section A5,7,1,4,6,3,2Section B1)F H I 2)A 3) C E J 4) B D G JExercise 31.passed out; in shock2. back and forth3. knows the reason why4. no doubt; living without her5. plays a great role6. brilliant boy7. very few cases8. deny; nature9. bright or not; should; CAN 10. thicker than; genetic relationship 11. react to; not to mention 12. hard decision; involvedPart TwoListening IExercise 11 F 2. F 3. T 4. F 5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed 8. language 9. young 10. alike 11. separated 12. apart 13. career 14. interestsListening IIExercise 11.b2.d3. a4. dExercise 2(1,4,6,8,10,11,12 ) yesPart ThreePractice oneExercise 1(3,6,9) yesExercise 21. six2. four3.1954. broad5. slim6. extended7. short8. elbows9. knees 10. size-14 11. lungs 12. heartPractice TwoExercise 11. 19212. fit the child3. ordinary schools4. adult conception5. BarbaraExercise 21. good being2.wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction9. scholars 10. scholars 11. street cleanersPractice ThreeExercise 11. c2.b3. c4. bExercise 21 F 2. F 3. T 4. F 5. FPractice FourExercise11 a 2. c 3. d 4. aExercise 21.F2. T3.T4. T5.T6. TPart Four Testing yourselfSection I1.talent2.dancing3.creative4. early5. physical6. energy7. less8. curiosity9. particularly 10. cause 11. fundamental 12. meaning 13. superior 14. fluently 15. read 16. exceptional 17 preparation 18. fullySection II1.F2. T3. F4. F5. T6. F7. F8. TSection III1. c2. a3. c4. b5. dKeys to the texts of book3Unit NinePart OneExercise 2 :1. c2. c E3. .c4. w5. w 6 c 7. c 8. c 9.c 10. w 11. w 12. w 13. c 14. w 15. w 16. c 17. w 18. wExercise 31.prefer; old- fashioned2. as old as3. account for4.own; play; earn a living5. very proud of6. had the chance7. hills; small bridges; singing of birds8. full of energy9. holes; buttons; precise; notes 10.indirectly; individualistic 11. places great importance on 12. a universal languagePart TwoListening IExercise 11 restaurants, airports supermarkets; banks 2. attitudes; in the right mood ; a better feeling; the people around him; happy; work better 3. world war II 4. happy; calm ; a machine; kinds of music ; different times; faster ; slowerExercise 21. T2. F3.F4.T5.T6. F7. T8.FListening IIExercise 11.eases their minds; operations2. classical; instrumental Jazz;folk music 3. reduce tension; 50 male doctors; Mathematics ; 1. quickly 2. calmly 3. chosen for them 4. no music 5. the worst sleepyExercise 21. T2. F3.T4. F5. FPart ThreePractice oneExercise 11. b 19622.d 19633.a 19644. c 1970Exercise 21. their own style2. the nature3. sounds; experimented4. songs; records5. films ; awardsPractice TwoExercise 11. (1) (2) (3)2.(2) (1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the string5. manages the bowExercise 3.1. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice ThreeExercise 11. T2. T3. T4. F5. F6. F7. F8. TExercise 2。
Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly BExercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. T Exercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 T Practice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection II1. B2. B3. D4. B5. D6. A7. C 8. BSection III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond8) independent9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. C Exercise 21. T2. F3. T4. T5. F6. F Listening III Exercise 11) stayed around 2) mouse catcher 3)rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7.F 8.TPractice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. D Practice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. A Exercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7.F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction4) species5) oxygen 6) economic 7) conservation8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa¥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ¥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. F Exercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. B Exercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.T Exercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by10. sense11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. A Exercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debate Part TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particularExercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.D Exercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory10. reduced11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. A Exercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages E Exercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking 8. convenient 9. restaurants 10. bathroomsExercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7)A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. D Section III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5,7,1,4,6,3,2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.T Part Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16.C 17. W 18.WExercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slowerExercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makesthe notes4. on the strings5. manages the bow Exercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. TExercise 2Bruce Springsteen: communicative, direct, exciting, simplerSting: naturalPeter Gabriel:musicalBranford Marsalis: brilliant, humorous Youssou N’Dour:not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damaged Exercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days 8. give up 9. stop trying10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. A Section II 1. C 2. B 3. D 4.A 5. B Section III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black11. white 12. shaking 13. wet 14. sweet15. delicious16. angel 17. grave 18. nights 19. days 20. taste。
VLS B3 Unit 1II. Basic Listening Practice1.ScriptW: Have you chosen your elective for next semester yet? Are you taking French writing again?M: Yes I am, but it’s compulsory for us next semester. So I think I’m gong to do marketing as an elective instead.Q: Which class will the man choose as his elective?2.ScriptM: Did you go to that businesses lecture on Friday? I missed it and need to copy your notes.W: I’d say you could borrow my notes, but Sarah’s got them. Be careful not to miss Professor Brown’s seminar; he takes attendance in that.Q: What is the woman telling the man?3. ScriptW: Wow, Steven! In the library! What brings you here?M: I’m enjoying the view. All the girls in fashion design are here are preparing for an exam on Monday. Q: Why is the man in the library?4. ScriptW: How’s your group doing with this statistics presentation? Mine’s terrible.M: Yeah, mine too. David and Mike are OK, but Steven doesn’t pull his weight and Suzie’s never around.I don’t see how we can pass unless Steven and Suzie realize that this is their last chance.Q: What is the true of Steven and Suzie?5. ScriptW: You took an MBA at Harvard Business School, didn’t you? What’s it like?M: It’s expensive, about U.S. $ 40,000 a year, plus the costs of food and housing. But the teaching is first class. The professors have a lot of practical experience. They use the case system of teaching; that is, you study how actual businesses grew or failed.Q: Why is he MBA teaching in Harvard Business School first class, according to the conversation? Keys: 1.C 2.D 3.B 4.D 5.AIII. Listening InTask1: On the First DayScriptHarrison: I’m Harrison. Good to meet you. So you’ve bought the books for this biology class.Jenny:Sure, I think everyone had to before class started.Harrison: No. Usually no one does much on the first day because it’s still add-drop.Jenny: What’s that?Harrison: Changing from class to class to find out which one is best. Hey, where are you from? Jenny: Poland. Have you has this teacher before? I’ve heard he is really good.Harrison: He’s good if you’re a hand-worker. He expects a lot.Jenny: Oh, I guess that’s good. I hope I can keep up with everyone else in the class. Maybe I need your help after class.Harrison: You’re welcome.…Professor: All right. See you guys next week.Student: See you.Jenny: Harrison, wait up!Harrison: So what do you think about the professor’s lecture?Jenny: I think half of what he said went over my head.Harrison: That’s all right. A lot of what he said is explain in the reading/Jenny: Hey, would you mind if I borrowed your notes tonight to look them over?Harrison: No problem. We don’t have class until Wednesday. Here you go.Jenny: Thanks. I just want to make sure I’m prepared for the seminar.Harrison: Yeah, participation in the discussion is an important part of the education here.Seeing that Jenny has bought the books for the biology class, Harrison says nobody does much on the first day because it’s still add-drop, which means students are changing from class to class. Jenny knows the professor is really good.But Harrison warns her that the professor is good, only if students are hand-workers, for he expects a lot.After class, Jenny admits that half of what the professor said went over her head, and Harrison assures her that a lot of what the professor said is explained in the reading.When Jenny asks to borrow Harrison notes, he says “on problem”, for they don’t have class until Wednesday. Finally, Harrison says participation in the discussio n at the seminar is an important part of the education there.Task 2: How to select elective courses?ScriptConsider these tips on elective courses and you'll choose those that will serve you best.To begin with, you should select the courses that fit your profession. It is a good idea to choose elective courses closely related to your chosen profession. Potential employers will appreciate every bit of extra training and knowledge that they don't have to give you. For example, you may select elective courses in chemistry, biology or even physics if you are doing a science major. For business majors, select electives in accounting, business administration, and even computing, as you'll never know when these will come in handy in the corporate world.Moreover, you can choose an education that includes many fields of study. If you are taking a heavy load of career-related courses, you may prefer electives that are not directly related to your major. If you receive a well-rounded education, some employers believe that you have better potential. For example, if you have courses in science along with your business degree, you could possibly win a job over someone who majored purely in business with no outside electives.Finally, you can also select a challenging elective course. Part of getting an education is learning how to learn, and elective courses should help you achieve this goal. You need not to memorize all theinformation from each class, but you should get a better understanding of the world. So, pick elective courses that challenge your belief system and make you look at the world in a different way. For instance, you can consider a philosophy elective if you have been told that you are a little narrow-minded.Key(1) extra training (2) chemistry(3) accounting (4) many fields of study(5) better potential (6) business degree(7) challenging (8) how to learn(9) better understanding (10) narrow-mindedTask3: How to Get Straight A’sScriptIt is interesting to note how straight A students achieve academic excellence. Here, according to education experts and students themselves are the secrets of super-achievers.First, they know how to set priorities. Top students allow no intrusions on study time. Once the books are open or the computer is turned on, phone calls go unanswered, TV shows unwatched, snacks ignored. Study is business, and business comes before recreation.Also, good students can study anywhere and everywhere. Claudia Hill, an Arizona State University business professor recalls a cross-country runner who worked out every day. Hill persuaded him to use his spare time to memorize biology term. Then he posted a list of biology terms on the mirror in the bathroom. He learned a few terms every day while brushing his teeth. Eventually, he scored high on the final examination.Moreover, top students schedule their time well. Study times are strictly a matter of personal preference. Some work late at night when the house is quiet. Others awake early. Still others study as soon as they come home from school when the work is fresh in their minds. All agreed, however, on the need for consistency. A student says, “W hatever I was doing, I maintained a certain period of time every day for studying.”Another important characteristic of super-achievers is that they know hoe to read, According to a book entitled Getting Straight A’s, the secret of good reading is to be “an active reader-one who continually asks questions that lead to a full understanding of the author’s message”.1.Which of the following is NOT mentioned about super—achievers starting to study?2.What did the runner do to score high on the exam?3.What is the good thing all top students agree on?4.What does the speaker mean by “an active reader”?5.What is the main idea of the passage?Kes: 1B 2.C3. D 4.A 5.DIV. Speaking OutMODEL 1 Y ou’re just going to have study hardNora: Only our first day back at school, and already I feel like I’ve learned a lot.Chris: Only our first day back at school, and I already feel like I’m up to my ears in homework.Nora: You’re going to have to hit the books if you want to keep your grades up.Chris: Tell me about it! I already have two reports, two books reports, a composition, an oral report, anda research project—all due before midterms.Nora: We could work together. Maybe some of my organized study habit would rub off on you.Chris: Better yet, maybe you could do my homework for me.Nora: Forget it! That would be cheating.Chris: All right, all right. I have yet to write a term paper. Can you recommend any articles and books?You’d better find me the exact pages where I can find what I want.Nora: You could borrow ideas from references, but if you quote without giving the sources, you’re plagiarizing.Chris: The quiz next week will be a headache. If you don’t help me, I’ll have to prepare some study sheets and hide them in my hand when I take the test.Nora: Oh, no! If you’re caught, the professor will definitely give you an F. Probably, you will have to repeat the year.Chris: All right, I’ll take your advice. The library is going to be my new home, and in the dorm I’ll be burning the midnight oil.Now Y our TurnSAMPLE DIALOGA: We’re going to have a test, and I also have a term paper to finish. But I haven’t done a thing. I’m really worried now.B: You’re going to have to have to hit the books if you want to get good grades.A: But this course is so difficult that I already don’t understand it at all.B: We could work together. Maybe some of my organized study habit can help you.A: Better yet, maybe you could write a term paper for me.B: Forget it! That would be cheating.A: All right, all right. I have yet to write it myself. Maybe I can download some articles from the Internet and piece them together.B:You could borrow ideas from those articles, but if you quote without giving the sources, you’re plagiarizing.A: Also, the test next week will be a headache. If you don’t help me, I’ll have to prepare a cheat-sheet and hide it in my hand during the test.B: Oh, no! If you’re caught, the professor will definitely give you an F.A: I’ll try to be careful.B: But if the professor catches you, you’ll have to repeat the year. You’re just going to have to study hard. A: Ok, I’ll take your advice. The library’s going to be my new home, and in the dorm I’ll be burning the midnight oil.MODEL2 Which class do you prefer?ScriptChris: First period is math with Mr. Woods. I don’t know how am I going to stay awake?Nora: I like Mr. Wood. He’s interesting.Chris: He’s boring! He could put the entire basketball team to sleep—during the championship game!Who do you have for economics?Nora: Mrs. Jenkins. She’s smart. Students really learn a lot from her.Chris: She’s tough! You have to work hard in her class, or you’ll probably fail.Nora:No pain, no gain.Chris: Nonsense, You could have learned even more with Mr. Sharp. But not many students opt for his class.Nora: What’s wrong with him?Chris: Often, the highest grade he gives on a term paper is C+, and he usually fails half of the students. Nora:No wonder he’s got the nickname Mr. Shark. Well, how about PE? What are you doing this semester?Chris: That’s the worst part. In PE, we’re learning t’ai chi. I’m bored to death.Nora: Ha-ha! Not to rub salt into the wound, but our class is playing your favorite sport: basketball. Chris: Oh…that figures! This is going to be a terrible semester.Nora: This is going to be a great semester!MODEL3 Publish or perishScriptChris: Tell us, Professor Grant, What are your primary duties as a professor?Professor Grant: Well,I do a lot of research and writing.It’s rough being an associate professor. It’s publish or perish.Chris: So you spent a lot of time in your office?Professor Grant: Yes, but I also have to prepare class motes, give lectures, hold office hours. Teaching is an important part of being a professor.Chris: With all those responsibilities, you must make a lot of money.Professor Grant: I wish. Actually, I spend a lot of tome applying foe grants to fund my research. Then I can offer assistantships and scholarships to the worthy graduate.Chris: I see why they call you “the boss”. But being a professor sounds pretty competitive. Professor Grant: Actually, I think you were in one of my classes…Chris: Um….I think you’re mistaken, Professor Grant!Professor Grant: No, I remember very clearly now! You owe me an essay!Chris: Sorry, I have too much work to do for the Student Union Newsletter, and I have to work two jobs to pay for school.Professor Grant:So you get an F in this course.V. Let’s TalkVI. Further Listening and SpeakingTask1:ScriptHi, everybody. My topic today is “Problems with Our Educational System”.There are a lot of things in our educational system that I don’t agree with. It seems that educators just want to give standardized tests, which focus only on academic performance but neglect students’ abilities and interests in other areas. I think there’re a lot of people who are very intelligent, but haven’t had the opportunities they could’ve had, had they been educated in a broader-minded educational systems. I feel that a lot of courses that students are focused to take in high school are too academic, and, as a result, many kids lost their interest in learning.Educators have failed to recognize various kinds of intelligence. They often exert a lot of pressure on students to be as well-rounded as possible. I think being well-rounded isn’t really possible. And as a consequence some students who are believed to be intelligent can’t get into good colleges if they, for example, haven’t scored well on the math section, even if they ate brilliant writers.Another thing that disturbs me is that the so-called “weak students”are separated from the rest of the school. Some kids are kept in a separate class id their grades are lower then others. And they’ve very aware of their social position, you know. I think it causes them to act in a way that is not really positive. They’re just acting in a way that they are expected to act. Often their grades go from bad to worse. And that’s pretty sad to me. I think that many of the kids in those classed are intelligent, but never actually realize their potential because of the way they are treated very early on in their education.Task 2: The Final ExamScriptAt a university, there were four sophomores taking a chemistry course. They were doing so well on all the quizzes, midterms, labs, that each had “A” so far for the semester.These four friends were so confident that on the weekend before finals, they decided to go up to the University of Virginia and party with some friends there. They had a great time, but after all the hearty partying, they slept all day Sunday and didn’t make it back to school until early Monday morning. Rather than taking the final then, they decided to find their professor after the final exam and explain to him why they missed it. They explained that they had planned to come back in time for the final exam, but, unfortunately, they had a flat tire on the way back, didn’t have a spare, and couldn’t get help for a long time. As a result, they missed the final.The professor thought it over and then agreed they could make up the final the following day. The guys were relieved and elated. The next day, the professor placed them in separate room, hand each of them atest booklet, and told them to begin.They took at the first problem, worth five points. It was a simple question on a chemical reaction. “Cool,”they thought at the same time, each one in his separate room, “This is going to be easy.” Each finished the problem and then turned the page.On the second page was a question worth 95 points: “Which of the tires was flat?”Task 3 Harvard UniversityScriptHarvard University is the oldest institute of highest learning in her United States. Founded 16years after the arrival of the Pilgrim at Plymouth, the university has grown from 9 students with a single master to the present enrollment of more than 18,000students, including undergraduates and students in 10 graduate and professor schools. Over14, 000 people work at Harvard, including more than 2,000 faculties. Harvard has produces six presidents of the United States and 34 Noel winners.During its early years, Harvard offered a classic academic course based on the model of English universities, but consistent with the prevailing Puritan philosophy. Although many of its graduates became ministers in Puritan church throughout New England, the university never formally affiliated with a specific religious group.Under President Pusey (1953-1971), Harvard started what was then the largest fund-raising campaign in the history of American higher education. It was an 82.5 million dollar program for the university. The program increased faculty salaries, broadened student aid, created new professorships, and expanded Harvard’s physical facilities.Neil L. Rudenstine took office as Harvard’s 26th president in 1001. As part of an overall effort to achieve greater coordination among the university’s school and faculties, Rudenstine encouraged academic planning and identified some of Harvard’s main intellectual priorities. He also stressed the important of the university’s excellence in undergraduate education, the significance of keeping Harvard’s doors open to students from families of different economic backgrounds, the task of as aping the research university to an era of both rapid information growth and serious fund shortage.1.What is main idea of the passage?2.How many teachers did Harvard have at the very beginning?3.What was the role of religion at Harvard University was during is early years?4.Which of the following is NOT mentioned as an achievement of President Pusey’s fund-raisingprogram?5.What did President Rudenstine do?Keys: 1.B 2.A 3.C 4.D 5.DViewing and speakingScriptHost: Well, David Lammy, the University Minister, joins me from Westminster. Now thanks for joining us this lunchtime, Mr. Lammy. How do these cuts_ tie in with your much trumpetedcommitment to increasing higher education?Interviewee: Well, I think it's important to remind viewers that we will spend well over 12 billion pounds on higher education this year and to also say that there will be more students at university next year than ever before in our history. But what is important is that when they get to university, is that they have good facilities, good buildings, that they have good contact with their lecturers and, for students from poorer backgrounds that they receive a grant. And you know 40 percent of students who are going to university are in receipt of some grants. So we have to plan. . .Host: But there's going to be less money next year. That's the bottom line, isn't it?Interviewee: Er, we are asking universities to make a one percent cut in their teaching grant. That's 51 million out of a total budget of over five billion. Look, I think there are families across the country preparing for Christmas spending a bit less and they're, you know, it's a lot more than one percent that they're, they're feeling. So I think this is reasonable to ask universities if we are to ensure that we can continue to send more young people to university and we remain committed to that. Host: And briefly, what about these two-year degrees? This is a reduction in standards, isn't it? Interviewee: Well, we, we, we. . . It's important in this country that we remember that students aren't just the classic 18- to 21-year-old undergraduates. We want mature students. We want more part-time students and over the last few years we've been growing the number of foundation degree, two-year degrees that ensure that transition into high university and high level skills. That's what we want to support and that's what we're indicating in the grant letter that we've sent to universities over the last few days.Host: OK. David Lammy, thank you so much for joining us.Interviewee: Thank you.Key(1) increasing (2) 12(3) more (4) facilities(5) lecturers (6) poorer(7) grant (8) one(9)budget (10) less(11) young (12) classic(I3) part-time (14) growing。
Unit 1Part TwoListening IInterviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality? Angela: Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian.Interviewer: That sounds complicated. Could you explain what you mean?Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home.Interviewer: Do different cultures have different ideas as to what is polite?Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person?Angela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly 7) look at my feet8) shy and silentListening III am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you hurt, cry, or are unhappy for people you don't know, or for a movie that is not real, then I think that's a little too sensitive. That's the way I am.I am a very independent person. I must do things for myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it, because I do. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like, and would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel, or how they live, or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me. Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice OneTom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test. Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different.Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice TwoDavid: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot ofquestions...er...he tends to speak first and think later. But he's got lots of interesting ideas. David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you? Barbara: Thanks.David: Bye.Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had halfa chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice FourA number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself.Statements1. It was easy to tell the English from the British.2. Speaking the same language helped one Australian visitor a lot.3. By "much nicer", one of the visitors meant that the British people were more friendly than people of other countries.4. The majority of continentals thought highly of English manners.5. To the young student from South Africa, Britain seemed to have a lot of foreign visitors. Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 1One day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection IITom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. Taylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything.Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. Tom, I think you'd better get on with your homework!1. B2. B3. D4. B5. D6. A7. C8. BSection III(S1 = the first speaker; S2 = the second speaker; S3 = the third speaker; S4 = the fourth speaker) S1: In this week's edition of Up with People we went out into the streets and interviewed a number of people. We asked a question they just didn't expect. We asked them to be self-critical...to ask themselves exactly what they thought they lacked or—the other side of the coin—what virtues they had. Here is what we heard.S2: Well...I...I don't know really...it's not the sort of question you ask yourself directly. I know I'm good at my job... At least my boss considers me hard-working, conscientious, and efficient. I'm a secretary by the way. When I look at myself in a mirror as you sometimes do in the privacy of your own bedroom...or at your reflection in the shop windows as you walk up the street...Well...then I see someone a bit different. Yes...I'm different in my private life. And that's probably my main fault I should say... I suppose I'm not coherent in my behavior. My office is always in order...but my flat! Well...you'd have to see it to believe it.S3: Well...I'm retired, you know. Used to be an army officer. And...I think I've kept myself...yes, I've kept myself respectable the whole of my life. I've tried to help those who depend on me. I've done my best. I am quite self-disciplined. Basically I'm a good guy, fond of my wife and family... That's me.S4: Well...when I was young I was very shy. At times I...I was very unhappy...especially when I was sent to boarding school at age seven. I didn't make close friends till later...till I was about...fifteen. Then I became quite good at being by myself. I had no one to rely on...and no one to ask for advice. That made me independent. My wife and I have two sons. We...we didn't want an only child because I felt...well I felt I'd missed a lot of things.1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond 8) independent9) shy 10) fifteenUnit 2Part TwoListening IMart Moody from Tupper Lake used to tell this tale. "I went out one day and there was a big flock of ducks out on Tupper Lake. And I had this good dog. I shot at the ducks, and then I sent the dog out there. She was heavy with pups at the time, and I didn't know whether I should send her out there. It was a cold day in the fall. Well, she took right off and away she went. But she didn't show up when it got dark. I began to worry about her. She was a good dog, a really good retriever. She'd get anything I shot at."So the next morning I woke up and I thought I'd better go and see if I could find her. And I got down to the shoreline of the lake and I looked out. Suddenly I saw something coming. It was this dog. She came into the shore! She had three ducks in her mouth. And behind her she had seven pups. And each of the pups had a duck in his mouth."Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening IIThere was an old man who had a daughter. He told his daughter that he had invited a preacher to his house. He said, "Daughter, I'm going down to the train to meet the Reverend, and I've roasted two ducks and left them there for him in the other room. Don't you touch them!" The daughter said, "No, I won't touch them." So her papa went to the train to meet the Reverend, and the girl began to taste the ducks. The ducks tasted so good that she kept on tasting them until she had eaten them all up, every bit of them.After the old man came back, he didn't even look in the place where he had left the ducks. He went directly into the other room to sharpen his knife on the oilstone so he could carve the ducks. The preacher was sitting in the room with the girl. She knew that her papa was going to punish her, and she started crying and shedding tears. The preacher asked, "What is the matter with you, girl?" She said, "Papa has this one bad fault: He invites preachers to his house and goes to sharpen hisknife to cut off both their ears." And the Reverend asked, "What is that you say, daughter?" The girl said, "Yes, Papa invites preachers here all the time and cuts off both their ears." The preacher said, "Daughter, hand me my hat. Quick!" The girl gave him his hat and he ran out of the door quickly. The daughter called her papa and said, "Papa, the preacher got both the ducks and has gone." The old man ran to the door and yelled to the preacher, "Hey, where are you going in such a hurry? Come back here right now!" But the preacher just kept running and shouted back over his shoulder, "Damned if you'll get either one of these."Exercise 11. A2. A3. B4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening IIIJack Storm was the local barrel maker and blacksmith of Thebes, Illinois. He had a cat that stayed around his shop. The cat was the best mouse catcher in the whole country, Jack said. He kept the shop free of rats and mice. But, one day, the cat got caught in a piece of machinery and got a paw cut off. After that, he began to grow weak and thin and didn't take any interest in anything, because he wasn't getting enough to eat.So, one day, Jack decided to make a wooden paw for the cat. He made it with his pocket knife and fastened it on the injured leg. After that, the cat began to grow sleek and fat again. Jack decided to stay at the shop one night to see how the cat managed with his wooden paw.After dark, the cat got down in front of a mouse hole and waited. Pretty soon a mouse peered out cautiously. Quick as a flash the cat seized it with his good paw and knocked it on the head with his wooden one. In no time, that cat had eighteen mice piled up in front of the mouse hole.Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice OneKen: Hey, Josh. Where did you get those comic magazines?Josh: When I went home last weekend, I found these old Superman magazines that my older brother had bought many years ago.Ken: You don't have time to read old comics. Why did you bring them here?Josh: In my World Literature class we've been talking about the importance of myths, folk tales, and legends to cultures. We have to write a short paper on which legendary figure we think is the great American hero. I think it's Superman.Ken: Superman? Why? I think it's someone like Paul Bunyan, the giant woodsman, or Johnny Appleseed, who planted early apple trees in the Midwest. Superman is just a modern comic magazine character.Josh: When I saw these old comics, I started thinking that Superman represents a combination of cultural traditions and beliefs that have been told throughout our American history.Ken: How?Josh: Superman is an orphan who comes by rocket to Earth when his native planet explodes. Helands near a small town and is adopted by Jonathan and Martha Kent, who teach him their American middle-class values of honesty, hard work and consideration for others. As an adult, he migrates to a large city and defends Americans against evil.Ken: What else?Josh: Well, I was thinking about this and realized that he is a symbol of the American character because he is an immigrant. We Americans have come from somewhere else, too. My great grandparents came from Germany, and I know your grandparents came from Brazil. They all worked hard and succeeded.Ken: But how does that relate to Superman?Josh: He goes to the city, just as many immigrants did, works as a newspaper reporter. But his adopted parents' values of honesty, hard work and helpfulness are a part of him. He uses his super abilities to fight dishonesty and to help the victims of crime and injustice, meanwhile working hard at his newspaper job.Ken: I understand. As an orphan, Superman becomes a new person in a new land, just as our ancestors did, and succeeds. He also represents our values. Your paper should be interesting. I'd like to read it when it's finished.Josh: OK.Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.TPractice TwoAt one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs instead of only for food. Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painful stiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you."The spirits of the deer would run to the place where a deer had been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If the answer was "yes", the spirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again.Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them.When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own.Finally they decided that each type of plant should provide a cure for one of the diseases which animals had caused for mankind.This was the beginning of plant medicines from nature among the Cherokee Indians a long, long time ago.Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. DPractice ThreeEvery March, a flock of buzzards returns to the town of Hinkley, Ohio. No one really knows how long this event has taken place, but according to local legend the annual buzzard migration began nearly 200 years ago with a massacre."The first legend of buzzards in Hinkley, Ohio, goes back to the Great Hinkley Hunt on December 24, Christmas Eve, in 1818. The local settlers deciding that the township needed to be made safe for their livestock, gathered together about 400 men and boys, with guns and clubs and completely surrounded the township of Hinkley."As the story goes, the townsfolk began marching toward the center of town, driving all the game in front of them, and killing virtually every wild animal they encountered."The settlers took some of the deer and the wild turkeys for the holiday dinners, but left all of the other dead animals out in the snow. When spring came, the remaining dead animals attracted many buzzards, and since 1819 they've been coming back here in March."Hinkley locals have come to appreciate the buzzards' annual return. In mid-March, on Buzzard Sunday, they celebrate the birds' arrival with costumes, exhibits and songs.Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice FourAlmost seven centuries ago, in Central Asia, there lived a great king called Tamerlane. He was a mighty, powerful, conquering soldier, and his greatest ambition was that one day he would rule a massive empire stretching from the Atlantic Ocean in the west to the Pacific Ocean in the east. He made his imperial capital in the oasis city of Samarkand, which he planned to make the most beautiful city on earth. Many magnificent mosques were built and they were decorated with exquisite blue ceramic tiles on the outside, and with pure gold on the inside.Tamerlane, like the great oriental king that he was, had many wives, including a Chinese girl called Bibi Khanym. Now Bibi Khanym was the most beautiful of all Tamerlane's wives, and she was also the youngest. She was his favorite wife and was deeply in love with him.In order to demonstrate her great love of Tamerlane, she decided to build a magnificent mosque to honor him, while he was away fighting in a distant war. She engaged the best architect, who designed for her the most magnificent mosque you could imagine. And then she found the best master builder, who began work immediately. But as the weeks and months passed by, the master builder began to fall in love with Bibi Khanym. She resisted all his advances, but at last he threatened to leave the mosque unfinished unless she allowed him to kiss her just once. Bibi Khanym wanted the beautiful mosque finished more than anything else. She was expectingTamerlane to return any day. So at last she agreed to let the master builder kiss her, just once.But that was her terrible mistake, for so powerful was the master builder's love for Bibi Khanym that when he kissed her he left a permanent mark on her face.King Tamerlane returned and saw the guilty mark on his wife's face. The master builder was executed immediately, and then, thinking that a woman's beauty can be a dangerous thing, Tamerlane ordered that from that day on all the women in the kingdom should never be seen in public without a veil to cover their face.Exercise 11. B 2 . C 3. B 4. A 5. D 6. AExercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 1Long long ago, there was a pretty girl named "Red Riding Hood" because she was always wearing a red hood. One day her mother asked her to take some snacks to her grandmother because her grandmother was ill. Her mother told her, "Don't hang around on your way. Don't leave the main road."On her way, she saw a wolf. The wolf asked her where she was going and she told him that she was going to her grandmother's house. The wolf thought to himself how delicious she would taste. Red Riding Hood danced in the woods, picking flowers for her grandmother and forgetting what her mother had said to her.The wolf went to the grandmother's house and ate up the poor lady. Then he waited in the bed for Red Riding Hood.As Red Riding Hood came into the grandmother's house, she found her grandmother looked rather strange with very large ears, eyes, hands and mouth. And suddenly the wolf jumped out of the bed and devoured the little girl.At that time, a hunter passed the house and heard loud snores made by the wolf. He went in and carefully cut the wolf's stomach open because he thought the wolf had probably eaten the grandmother. Then both little Red Riding Hood and her grandmother escaped from the wolf's stomach. After that, Red Riding Hood remembered the importance of her mother's words and never left the main road again.Questions:1. Why was the girl called "Red Riding Hood"?2. What was she asked to take to her grandmother?3. What did her mother tell her NOT to do on the way?4. How did the wolf think Red Riding Hood would taste?5. What did the wolf do to both the girl and her grandmother?6. Who rescued Red Riding Hood and her grandmother?1. C 2 . B 3. C 4. B 5. A 6. CSection IIMoon was sad. She had spent many years looking at the people on Earth and she saw that they were afraid. They were afraid of dying. To make them feel better she decided to call on her friend Spider to take a message to them."Spider," she said. "The people on Earth are afraid of dying and that makes me very sad. Please。
视听说I I I原文和答案U n i t2(总8页)--本页仅作为文档封面,使用时请直接删除即可----内页可以根据需求调整合适字体及大小--VLS B3Uint2II. Basic Listening Practice1.ScriptM: Now we have satellite and high-powered microscope, it’s easy to think we know everything about the world; but we still don’t understand EI Nino.W: Right. Scientists all over the world over are even uncertain about the cause of the warm Pacific current that brings storms or drought—the mysterious EI Nino.Q: Which of the following is true according to the conversation2. ScriptM: Everyone is talking about environmental problem: acid rain, the greenhouse effect, holes in the ozone layer. We should think positively. What can we do to improve thingsW: I agree. We could do a lot more to harness the sun’s energy for heating and lighting in our homes. In Japan 43,000 solar roofs were installed in 2002.Q: How do the man and the woman view the environment3. ScriptW: We lived in Beijing some years ago. It was always difficult to keep the house clean with wind from the north blowing sand from the desert at us.M: That’s why the Chinese government has been encouraging people to plant trees along the edges of the Gobi Desert. Now those trees act as wind barriers.Q: What did the government encourage people to do4. ScriptM: Many old refrigerators and cars are environmental hazards because they contain CFCs that destroy the ozone layer.W: Yes, but government or organizations are helping people to safely dispose of old refrigerators or, in the case of cars, to upgrade their air conditioning.Q: What are government departments helping people to do5. ScriptM: Hey, that’s an aerosol spray you’re using on your hair! Build a bomb or set fire to the apartment to kill us quickly instead of making holes in the ozone, so we die of cancer.W: Cool it, man. This spray doesn’t contain CFC s. And you’d better read a little more. In 2003 the hole in the ozone layer shrank by 20 percent, so there’s no reason to panic.Q: What does the man meanKeys: 3. AIII. Listening InTask 1: We should have proper respect for nature!ScriptMartha: Do you think most people in your culture respect natureEd: I think so. Umm…more now than before.Martha: What do you think is the most serious environment problem in the world today Ed: Today…I think damage to the ozone layer is a big problem; and another problem is pollution in big cities and things like that.Martha: How do you learn about environmental problemsEd: Umm…through school. A lot of clubs promote environmental safely, and some TV programs, too. They talk about environmental safely and stuff like that. Martha: Do you think students should learn more about the environment at schoolEd: I think so. So, as they grow older, they can be more aware of all the problems that are going on. And also to prevent more problems from occurring. Martha: If you could create a new law to help the environment, what would it beEd: A new law for the environment Umm…I’d probably say that when people throw away their cigarette butts, they have to throw them into the garbage bin,not just throw them everywhere because it’s just littering and I hate that.So they should be fined if they throw them on the floor on the ground. Martha: That’s a good idea. What do you personally do to help protect the environmentEd: I’ m so against littering. I never litter. If I see somebody litter, I get really angry. So I always throw my trash into the garbage bin.While being interviewed by Martha, Ed said more people in his culture respect nature ever before. When asked about the most serious environmental problem in the world today, he mentioned the damaged ozone layer and the pollution in big cities.Ed learned about environmental problem at school. A lot of clubs and some TV programs promote environmental safely. He believes that students should learn more about the environment at school. Then they can be more aware of all the problems and prevent more problems from occurring.When asked about a new law he would like to create to help the environment, hesaid that when people throw away their cigarette butts, they have to throw them inthe garbage bin. They should be fined if they throw them on the floor.Personally, Ed is so set against littering that he never litters. He always throwshis trash into the garbage bin.Task 2 River pollutionIf you see dead fish floating on the river or notice that the water is discolored and smelly, you know the river has been polluted, and there are four main possible causes for it.First, fertilizer. If large amounts of fertilizer or farm waste drain into ariver, the concentrations of nitrate and phosphate in the water increase considerably. Algae use these substances to grow rapidly, turning the water green. This massive growth of algae leads to pollution. When the algae die, they are broken down by the action of the bacteria, which quickly multiply, using up all the oxygen in the water and therefore causing the death of fish.Second, industrial waste. Factories sometimes discharge chemical waste into rivers. Examples of such pollutants include cyanide, lead, copper, and mercury. These substances may enter the water in such high concentrations that fish and otheranimals are killed immediately. Sometimes the pollutants enter the food chain and accumulate until they reach toxic levels, eventually killing fish and other animals.Third, oil pollution. If oil enters a slow-moving river, it forms a rainbow-colored film over the entiresurface, preventing oxygen from entering the water.Fourth, warm water. Industry often uses water for cooling processes, sometimes discharging large quantities of warm water back into rivers. A higher temperature of the water lowers the level of dissolved oxygen and upsets the balance of life in the water.Questions and key1. What is the passage mainly aboutD) The causes of river pollution.2. Why does the river water turn greenA) Because nitrate and phosphate in the water increase.3. What harm does industrial waste causeB) Poisoning.4. Which of the following is true of oil pollutionC) It prevents oxygen from entering the water.5. What harm can warm water in a river bringD) Lack of oxygen.Task3: Curbing Carbon emissionsScriptAlthough it is not an easy task, China is striving to fulfill the promise to cutits carbon dioxide emissions per unit of GDP by 40 to 45 percent in the next 10 years.Zhang Guobao, Director of the National Energy Administration, said, "The government puts great emphasis on seeking harmonious development between cities and the environment, and is readjusting the energy structure by giving priority to the development of clean and low-carbon energies, including hydroelectric, nuclear, wind, and solar power."Government authorities have closed small, coal-fired plants with a total capacity of million kilowatts in the past four years. This year's target of closing 10million kilowatts of capacity will be achieved by August. "We have promised to the international community that 15 percent of our power will be generated from non-fossil sources by 2020," Director Zhang said. At present, non-fossil energy accounts for only percent.China is making efforts to increase the proportion of clean energy in its total energy consumption. Statistics show that China invested US$ billion in clean energy last year, exceeding the United States which invested US$ billion. Thus, China has become the world leader in generating clean energy. Five years earlier, China's investment in clean energy was only US$ billion.However, China's carbon emission reduction target cannot be achieved easily. The shift to a low-carbon economy might be met at a cost to society. For instance, more than 400,000 people were laid off as a result of the shutdown of small coal-fired power plants in the past four years. Many studies indicate that the effort to curb greenhouse gas emissions may delay China's development, affect people's income, and lead to unemployment.Questions and keyl. What is the passage mainly aboutD) Cutting carbon dioxide emissions: China's achievements and problems.2. From four years ago until August this year, how many kilowatts of coal-fired plant capacity willhave been closedD) More than 70 million.3. By 2020, what will be the proportion of non-fossil energy in the total powerin ChinaA) 15%.4. Which of the following is true of the investment by China and the United States in clean energy last yearB) China's investment was almost twice as large as the United States'.5. Which of the following is NOT mentioned in the passage as a problem arising from curbing greenhouse gas emissionsC) Causing more strikes.IV. Speaking OutMODEL 1 Our globe is in dangerJohn: How is your Grandma getting along during this usually hot weatherNora: Over the last few years, Granny has been complaining that the hot, humid weather is killing her. She believes the weather has changed.John: What she means is the climate’s long-term conditions; weather refers only to day-to-day conditions.Nora: Yeah, she says summer is hotter, and winter wetter. But I tried to comfort her, saying, “It’s all in your mind, Granny.”John: She’s right, you know. The greenhouse effect does bring global warming and rain.Nora: How can I explain global warming and greenhouse gases to a 97-year-old Granny John: Tell her the earth now is like a real greenhouse made of glass panels that let in light and trap heat.Nora: Think she’ll want to know that carbon monoxide from earth makes greenhouse gasesJohn: Everybody should know what cause global warming; otherwise we won’t stop it.Nora: I’ll tell Granny not to burn any more wood or coal, or to use spray on the hair.John: OK, joke about it, but it won’t be so funny when the polar icecaps melt and oceans rise.MODEL2 Rainforests will soon be only a memory.ScriptSusan: Hey, Chris, there is an environmental group on campus asking for donations to save the rainforests.Chris: So whatSusan: So what! Don’t you want to save the rainforestsChris: But there’re no rainforests in our country. They need hot, tropical climates. Susan: Come on. A rain forest is any forest where heavy rainfall leads to dense vegetation. Tropical rainforests can be found in hoe, tropical areas, but there are also cool rainforests, including one in southeast Alaska.Chris: How did you know thatSusan: Well, I’ve just read a book on rainforests. You know, 140nillion people live in the world’s rainforests, and 35 percent of the world’s plant and animalspecies exist only in rainforests.Chris: Wow, I’m impressed. So what else have you learnedSusan: Most of the world’s rainforests are in danger of destruction by loggers, farmers and developers. They are disappearing at a rate of 1000 acres a minute! Chris: It’s terrible!Susan: Yeah, we’ve got to find a way to save them. Now would you like to give a donationChris: Sure.Now Your TurnSAMPLE DIALOGA: Most of the world’s rainforests are in danger of destruction by loggers, farmers and developers. They are disappearing at a rate of 100 acres a minute!B: What a tragedy! , Many of the world’s plant and animal species exist only in rainforests.A: We really need to save the beautiful forests.B: Yeah, we’ve got to find a way to save them.A: Do you know our mayor is making a call to plant treesB: Yeah, we do have to plant more trees. I hear China doesn’t have a lot of forests compared with many countries.A: That’s true. I’ve just read an article about afforestation. China’s forest coverage rate was last yea, ranking only 130th in the world.B: No wonder we have to plat more trees.A: Don’t lose heart. Progress has been remarkable. In 2000 the rate was just percent.B: Any other good newsA: China has stepped up its tree-planting efforts. Now it’s the world’s planter of trees.B: Wow, I’m impressed.MODEL3 What a terrible sandstorm!ScriptSusan: Hey, John. You’re back. A few days ago, a big sandstorm hit our cityJohn: Oh, that’s bad.Susan: The air was full of dirt and sand and dust. I had to wear a scarf around my head.John: The dust, as I know, comes from Mongolia. And from my reading in science, I’ve heard the dust often comes after a long period of drought.Susan: This is a serious problem in many parts of the world, and unfortunately our city is one of them.John: And if the drought continues, the soil is easily airborne. And then if the wind comes, the soil can be lifted up on the cold are that rises up, and it cantravel very long distances.Susan: Normally, when there’s a wind, it can clear the air, and you have beautiful weather. But when the dust is brought in with the wind, then you can’tbreathe, you can’t see well, and it’s dangerous for driving, or for walking.John: Yeah. You know, when the dust is lifted up it can go as high 3,000 meters. And it’s not just China that has problems, but many other countries. For example,the middle of Australia sometimes has dust storms, and some of the dust goes upvery high, goes across the ocean, and falls down on New Zealand.Susan: Not a very nice neighbor.John: Is there a solution to the problemSusan: We need to plant more trees and grass so that the soil can stay where it is.John: No wonder the government is launching a new afforestation program in a bid t address the environmental problem.V. Let’s TalkMan 1: Well, it's inspirational language which is nice and lovely and fluffy, but doesn't really actually commit anyone to doing anything, and so it'sreally hard to take to the bank. I mean, people's lives are on the linein the developing world where we are seeing the impacts felt first and foremost, And obviously the atmosphere simply can't take the kind of emissions we've beenseeing in the business-as-usual scenario and there's no realcommitment to change that. There's no real commitment to put seriousmoney on the table and that's a big problem.[On-screen text: Wind Farm]This is a great photo op for all the world leaders, but if it's not backed by action, it really doesn't mean much at the end of the day.Man 2: What's in there is very disappointing. It does not constitute a_ a deal. It'sa hollow shell that will need to be filled in, and it has some numbers,it talks about trying to avoid two degrees. That's the same languagethat the G8 used last July. But it lacks anything on emissions cuts as yet that would guarantee that we're actually on the, on track to get there. And the financing commitments... there is a mention of a 1OO-billion-dollar figure and the attempt to raise or mobilize that level of resources, but there's no guarantee that there will be new money, that the money will be real, that there's actually a commitment to get there, or that it will be channeled in new ways, as yet.Key(1) -b (2) - a (3) -h (4) -d(5)-g (6)-e (7)-c (8)-fVI. Further Listening and SpeakingTask1: The environment and the developmentScriptLi: Hi Professor Wang, I’m Li Lin, a correspondent from the University Newspaper.The staff and students here are getting more and more interested in therelationship between the environment and development. What do you think is the most serious environmental problem at present What measures should we adopt to improve the environment and develop the economy at the same timeWang: There are many environmental problems: air pollution, water pollution, desertification, over-fishing, destruction of natural habitats, acid train,over-consumption of wild animals and plants, etc. But lying at the center ofall those problems, as I see it, is the contradiction between economic growth and the environment.Since the United Nations Earth Summit in 1992, more and more people andgovernments have adopted a new idea; that is, “sustainable development”.This means today’s economic growth should not wipe out he resources andoptions for future generations. Planning and development should ensure notonly economic growth, but also social advancement and environment health. Inother words, some economic behavior must be restricted or controlled.Instilling principles of development into government planning, resourcemanagement and economic policy is the most important step China could take to solve its environmental problems.China has already taken some remarkable steps to reduce damage to theenvironment. For instance, following the huge floods of 1998, the governmentbanned logging in the upper reaches of the Yangtze River in order to protectforests and reduce the risk of floods.Still, the basic contradiction between environment and development persists.Much work is to be done before we can achieve the aim of a balance betweeneconomic growth and the environment.Task 2:ScriptA United Nations study says that a thick cloud of pollution covering southern Asia threatens the lives of millions of people. Scientists say the pollution could increase lung disease and cause early deaths. The cloud is also damaging agriculture and affecting rainfall levels. It has affected many countries in southern Asia. The pollution cloud is three kilometers high. Scientists say it can move halfway around the world in a week.The cloud is the result of forest fires, the burning of agricultural waste, and huge increases in the burning of fuels by vehicles, industries and power stations. Pollution from millions of bad cooking stoves hs made the problem worse. Many poor people burn of fuels wood and animal waste in such stoves.Scientists say this combination could be changing winter rainfall levels in Asia. They say rainfall has increased over the eastern coast of Asia. But it has dropped sharply over parts of northwestern Asia. The report says the cloud could reduce rainfall over northwestern Pakistan, Afghanistan, and western China by up to forty percent.Harmful chemicals from the cloud are mixing with rainfall. This acid rain damages crops and trees and threatens public health. Scientists are concerned that the pollution will intensify during the next thirty years as the population of Asia increase to an Estimated 5,000 million people.1.What is the true of the cloud of pollution2.What is NOT the cause of the cloud of pollution3.What does the cloud of pollution bring about4.Why will the pollution intensify in the next 30 years, according to the passage5.What do you think is the best title for the passageKeys:Task 3 Mountain regions face a number of dangers.ScriptMountain people around the world are in great danger of the negative effects of the worsening environment, according to a UN report.As global warming and deforestation accelerate and technology makes wilder places more accessible, environmental and social pressures on the world’s remotest regions increases.The UN has found that many mountainous regions—inhabited by one out of five of the world’s people—are barely recognizable when they are compared to what they ere like 60 years ago. This is mostly because forests were cut to make way for cattle grazing and agriculture.The authors of the UN study expect 98 percent of its mountain areas to experience severe climate change by 2055. Biological losses are expected to be heavy. The mountains of Europe, part of California and the northwest Andes in South America are among the most threatened mountain areas in the world and should be given priority in conservation.The UN is anxious to raise awareness of the problem facing mountain areas because they are inhabited by some of the most vulnerable people. These people could lose their culture and their livelihood with even the smallest shifts in climate.At the same time, many mountain regions are losing people. Thousands of villages in Europe are deserted most of the year. In other areas like Nepal, people are drifting to the cities in search of work.Viewing and speakingScript and keyWeather experts may have found a new problem caused by global warming, one which many people will pay attention to: There are (l)signs that Santa's home in the North may be in trouble because of (2)warmer temperatures.The Finnish town of Rovaniemi on the Arctic Circle, which many Europeans say is the home of Santa Claus, has had its (3)warmest winter in 40 years. As a result, therehas been much less snow than usual-meaning no snowmen, no snowballs, and possibly not enough (4)snow for Santa to ride his sleigh on.More important for local residents, it may mean fewer tourists, as well. Santa'swintry home town normally (5)attracts thousands of visitors each year, and millionsof dollars.Anne Pelttari-Bergman, the town's tourist director, worries that the town could be in (6)trouble if snow levels do not return to (7)normal. She explains: "Snow is really important for us, of course, for Santa Claus, for Christmas tourism, and also for our winter tourism because winter is our (8)best season. It is really important for us."Weather experts and town residents are hoping this warm winter is a (9)one-time thing. Few people can imagine a holiday when even Santa does not have a (l0)white Christmas.11。
Unite 1Practice oneTom: Hey, Bill. Do you have any plans for this weekend?Bill: Y eah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test. Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different.Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Practice 2David: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad w ith fair hair. V ery friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas. David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Y es, there is Maria. She's Susan's sister.David: Y es.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you? Barbara: Thanks.David: Bye.Practice 3:1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. Y ou can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of thestudents threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Practice four:A number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By muc h nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "Y ou're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself.Part four Testing yourselfSection two:Tom; oh, that Mr. Taylor. He is so boring!Mother; what do you mean?Tom: his less ons put me to sleep. And he’s so quick-tempered, mum.Mother: quick-tempered? Mr. Taylor? Are you sure darling?Tom: yes, he gets angry very quickly.Mother; that doesn’t sound like Mr. Taylor at all!Tom: and do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: really/. And why does he do that/Tom: because he’s vain, that’s why! And conceited. He thinks he knows everything.Mother; oh, Tom. Be reasonable. I’m sure you’re exaggerating. Mr. Taylor seems suc h a nice, kind man.Tom: well, he isn’t. he is mean and cruel.Mother; cruel/ no how can a foreign teacher be cruel/Tom: because he only gave me two out of ten points in my history test.Mother: oh, now I understand. Tom, I think you’d better get on with your homework.Unit 2Practice oneAt one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs instead of only for food. Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painful stiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you."The spirits of the deer would run to the place where a deer had been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If the answer was "yes", the spirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again.Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them.When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own. Finally they decided that each type of plant should provide a cure for one of the diseases which animals had caused for mankind.This was the beginning of plant medicines from nature among the Cherokee Indians a long, long time ago.PRACTICE 3:Every March, a flock of buzzards returns to the town of Hinkley, Ohio. No one really knows how long this event has taken place, but according to local legend the annual buzzard migration began nearly 200 years ago with a massacre."The first legend of buzzards in Hinkley, Ohio, goes back to the Great Hinkley Hunt on December 24, Christmas Eve, in 1818. The local settlers deciding that the township needed to be made safe for their livestock, gathered together about 400 men and boys, with guns and clubs and completely surrounded the township of Hinkley." As the story goes, the townsfolk began marching toward the center of town, drivingall the game in front of them, and killing virtually every wild animal they encountered."The settlers took some of the deer and the wild turkeys for the holiday dinners, but left all of the other dead animals out in the snow. When spring came, the remaining dead animals attracted many buzzards, and since 1819 they've been coming back here in March."Hinkley locals have come to appreciate the buzzards' annual return. In mid-March, on Buzzard Sunday, they celebrate the birds' arrival with costumes, exhibits and songs. PRACTICE 4:Almost seven centuries ago, in Central Asia, there lived a great king called Tamerlane. He was a mighty, powerful, conquering soldier, and his greatest ambition was that one day he would rule a massive empire stretching from the Atlantic Ocean in the west to the Pacific Ocean in the east. He made his imperial capital in the oasis city of Samarkand, which he planned to make the most beautiful city on earth. Many magnificent mosques were built and they were decorated with exquisite blue ceramic tiles on the outside, and with pure gold on the inside.Tamerlane, like the great oriental king that he was, had many wives, including a Chinese girl called Bibi Khanym. Now Bibi Khanym was the most beautiful of all Tamerlane's wives, and she was also the youngest. She was his favorite wife and was deeply in love with him.In order to demonstrate her great love of Tamerlane, she decided to build a magnificent mosque to honor him, while he was away fighting in a distant war. She engaged the best architect, who designed for her the most magnificent mosque you could imagine. And then she found the best master builder, who began work immediately. But as the weeks and months passed by, the master builder began to fall in love with Bibi Khanym. She resisted all his advances, but at last he threatened to leave the mosque unfinished unless she allowed him to kiss her just once. Bibi Khanym wanted the beautiful mosque finished more than anything else. She wasexpecting Tamerlane to return any day. So at last she agreed to let the master builder kiss her, just once.But that was her terrible mistake, for so powerful was the master builder's love for Bibi Khanym that when he kissed her he left a permanent mark on her face.King Tamerlane returned and saw the guilty mark on his wife's face. The master builder was executed immediately, and then, thinking that a woman's beauty can be a dangerous thing, Tamerlane ordered that from that day on all the women in the kingdom should never be seen in public without a veil to cover their face.PART FOURSection 1long long ago, there was a pretty girl named "Red Riding Hood" becasuuse she was always wearing a red hood. One day her mother asked her to take some snacks to her grandmother because her grandmother was ill. Her mother told her, “Don’t hang around on your way. Don’t leave the main road.”On her way, she saw a wolf. The wolf asked her where she was going and she told him that she was going to her grandmother’s hous. The wolf thought to himself how delicious she would taste. Red Riding Hood danced in the woods, picking flowers for her grandmother and forgetting what her mother had said to her.The wolf went to the grandmother’s house and ate up the poor lady. Then he waited in the bed for Red Riding Hood.As Red Riding Hood came into the grandmother’s house, she found her grandmother looked rather strange with very large ears, eyes, hands and mouth. And suddenly the wolf jumped out fo the bed and devoured the little girl.At that time, a hunter passed the house and heard loud snores made by the wolf. He went in and carefully cut the wolf’s stomach open because she thought the wolf probably eaten the grandmother. Then both little Red Riding Hood and her grandmother escaped from the wolf’s stomach. After that, Red Riding Hood remembered the importance of the mother’s words and never left the main road again.SECTION 2Moon was sad. She had spent many years looking at the people on Earth and she saw that they were afraid. They were afraid of dying. To make them feel better she decided to call on her friend Spider to take a message to them."Spider", She said, "The people of Earth are afraid of dying and that makes me very sad. Please tell them that they will all die sooner or later but it is nothing to be scared of."So Spider slowly made his way back to Earth, carefully picking his way down on moonbeams and sunbeams. On his way he met Hare."Where are you going Spider?", said Hare."I am going to give the people of Earth a message from Moon.", he said."Oh, you'll be far too long. Tell me the message and I'll take it there for you", replied Hare."OK! Moon wants the people of Earth to know that they will all die......", Spider started."Right! Tell the people of Earth that they will all die", said Hare. And with that, Hare disappeared off to Earth.Spider gloomily made his way back to Moon and told Her what had happened. Moon was very cross with Hare and when he came back to tell them that he had given them the message, she hit him on the nose! And that is why to this day, the Hare has a split lip."Y ou had better take the message yourself", said Moon to Spider.And to this day, Spider is still carefully carrying Moon's message and spinning the web in the corner of our rooms - but how many of us listen?SECTION 3:We don’t often know how a word or a legend associated with that word started; however, in the case of the American “cowboy”we do. The cowboy legend began in 1867 when the first transcontinental railroad was being built across the American West.A branch line of the new railroad went to Abilene, Kansas. In Abilence, a 29-year-old cattle merchant, Joseph McCoy, had a plan that made him a millionaire and put his name in dictionaries. His plan was simple. He knew that in the high grasslands of southern Texas ther were large herds of cattle. If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East, where they would bring good prices. He bought a lot of land close to the railroad in Abilene, where cattle could be kept before being shipped, and put his plan into action.McCoy advertised for ranchers and cow-handlers to bring their herds of cattle to his new railway cattle yard in Abilene. He offered $40 for each of the cattle, ten times more than anyone else did. One hundred days after his offer was made, the first herds arrived from the South. Each heard had two or three thousand cattle in it. In the next four years, McCoy shipped more than tow million cattle to the North and East. He soon became a millionaire.McCoy referred to the men bringing the cows to Abilene as “cowboys”. Soon there were at least 5,000 cowboys bringing cattle up to Kansas from Texas. Because the camera had recently been developed, many photos were taken of the cowboys and their long trips with the cattle. These photos were published in eastern newspapers and the cowboy became an Americans folk hero. Soon writers, such as Zane Gray, were writing books about the cowboys and their adventures. Thus the legend of the cowboy grew and developed into the 20th century.Unit 3Practice 1I took a trip recently into the heart of the Amazon Basin where one of the big issues facing our planet stands out: the balance between economic development and the conservation of natural resources. There is strong pressure in the country to harvest natural riches for short-term financial gains. Then there is intense international concern about the control of such development. The problem, of course, is that this is a one-way street. Rapid development, and wholesale harvesting of timber, oil, and the like, will soon lead to the Amazon desert, which would mean the extinction of halfour planet's animal and plant species and the depletion of much of the oxygen we breathe. This clearly impacts every one of us.The local people of the Amazon understand the delicate balance of nature. They've survived for thousands of years by making good use of it, not abusing it??something we can all learn from. And now tourism is playing a positive role in the equation. Travelers from more developed countries are increasingly interested in the natural world. As a result, they are fueling a boom in eco-tourism. This is in turn bringing valuable income into the region, raising awareness of critical issues and helping slow down the otherwise uncontrollable developmentPractice two:It isn't strictly true that one half of the world is rich and the other half is poor. It is one-third that is very rich and two-thirds that are very poor. People in the rich third don't realize the enormous difference between them and the other two-thirds. A very simple example is that a dog or a cat in North America eats better than a child in many of the poorer countries. A fisherman in South America may be catching fish which are processed into pet food and yet his own children are not getting enough protein for their bodies to develop properly. Although a lot of the world's natural resources come from these poorer countries, people in the richer countries are probably using much more of these resources than people in Asia or Africa. The richer countries are in a position to dictate to suppliers what kind of prices they are prepared to pay for these natural resources. In some cases the prices have gone down. In others they have remained steady. But the prices the richer countries get for their own exports have continued to rise. So, they are getting richer and richer, and the poorer countries are getting poorer and poorer.Practice 3:I kept seeing the news pictures in my mind. What could I do? I was only a pop singer --- and by now not a very successful pop singer. All I could do was make records which no one bought. But I would do that, I would give all the profits of the next Rats record to Oxfom. What good would that do? It would only be a little money but it was more than I could give just from my bank account. Maybe some people would buy it because the profits were for Oxfam. And I would be protesting about this disaster. But that was not enough.Practice 4:Marsha and Ed Gibson are sitting at the kitchen table. Ed is nervous and upset, andhe's smoking. Marsha's eyes are red. She looks tired. Their children, two boys, eight and ten, are sitting with them. Tony and George know that their parents are having problems. Now, their parents are telling the boys that they're going to get a divorce. Their mother is talking first. She's telling them that she loves them and their father loves them, too. But she and their father are having problems. They aren't going tolive together as a family anymore. It has nothing to do with the boys. The boys are going to live with her. They're going to stay in the same house, go to the same school, and be with all their friends.Now, their father is talking. He's going to leave the house this weekend. He's not going to move far away; he's going to be in the next town. Two weekends a month, the boys are going to stay with him. And, they're going to be with him one month in the summertime. He'll take his vacation then and they'll go to the beach. The boys can call him anytime. He's going to be nearby. It'll be better this way.Tony and George don't really understand what's happening. On the one hand, they know that their parents aren't happy. On the other hand, they want everyone to stay together.Section 2:Last month, the Wilsons went to Green Trees Park. Jim and Sally sat under the trees and talked and read. The children played ball.Sally decided to take a picture of the chidren. She took her camera and walked over to them. She focused her camera. Then, she heard a scream. Sally looked up. A man was stealing a woman’s purse. He was running in her direction.Sally thought fast. She took three pictures of the man. When the police came, she gave them the film.The next day, one of Sally’s photography was in the newspaper. Under it was the story of the robbery. In a few hours, the police knew the man’s name and address. They went to his house and arrested him. The man is now serving three months in jail.Section 3:In many countries in the process of industrializat ion, overcrowded cities become a major problem. Poor conditions in these cities, such as lack of housing, inadequate means of keeping places clean and healthy and lack of employment, bring about an increase in poverty, disease and crime.The over-population of towns is mainly caused by the drift of large numbers of people from the rural areas. These people have become dissatisfied with the traditional life of farming and have come to the towns hoping for better work and pay.One possible solution to the problem would be to impose registration on town residents. Only officially registered inhabitants would be allowed to live in the towns and the urban population would thus be limited. In practice, however, this causes a great deal of resentment, which would ultimately lead to violence.The only long-term solution is to make life in the rural areas more attractive, which would encourage people to stay there. This could be achieved by rewarding people for going and working in the villages. Facilities in the rural areas, such as transport, health and educaiton services, should be improved. Educaiton should include training in improved methods of farmingand other rural industries, so as to foster a more positive attitude to rural life. The improvement of life in the villages is doubly important, because the towns themselves cannot be developed without the development of the rural areas.Unite 4Practice 1W: Look. Here's a job that might interest you.M: What is it? Are you sure? The last job interview you sent me off to was a disaster.W: Well, look. It says they want a sales manager, and it looks like it's a big international company.That'd be good. You might get to travel.M: What kind of company is it, though?W: Um, let's see. Yes, it's a textile company that seems to import from abroad. They say the salary is really good. They operate a system of paying you a basic salary and then offering you a sales commission on top of that. They say it is high. And oh, look! They give you a car to travel round in. That's not bad, is it?M: Um, do they say anything about experience?W: Um, let's see. No, they want someone young with ambition and enthusiasm. Oh yes, they want graduates, so that's OK. You've been to university. Now what else? Let's see.M: There must be some catch.W: No, the only thing is you have to travel, but then that's what the company car's for. Oh, and you have to be able to get on well with other people because it says you have to be good on a team. M: Um, perhaps I'll have a closer look at that one.Practice 2W: Now what do you want to see me about, Janet?J: Well, I have a few questions I'd like to ask you, Mr. Womack. Can you give me some information about secretarial jobs?W: Yes, of course. First, let me get your file out. Now you're 16, aren't you?J: That's right.W: Well, what would you like to know?J: About the opportunities in general and the basic training, and things like typing speed and shorthand speed.W: Before we go any further, Janet, when you said secretarial work, did you only mean typing or more general things?J: Well, I suppose I'd have to start as a word processor operator, wouldn't I?W: If you left school at sixteen, yes. But if you wanted to have a better chance of getting a more interesting secretarial job more quickly, it would be better if you stayed on and took A levels.According to your file, your English is good, and you've done French and economics, haven't you?J: Yes, they're my best subjects. If I stayed, what A levels would I need to be a secretary?W: That depends, but those three subjects are all very suitable.J: And then I suppose I'd have to do a secretarial course, wouldn't I? Um, what sort of speed do they expect?W: I've got the typing speed here, I think. Oh, yes, it should be 65 words per minute.J: And would I have to learn shorthand?W: Yes, you would. You'd need a speed of 90 to 100 words a minute.J: Oh, it sounds a lot, doesn't it? Would I have a chance to use my French?W: Oh, yes, if you were a secretary with languages.J: What sort of work would I have to do?W: Well, you'd have to translate letters, of course, but you'd also have to answer the phone to foreign callers and interpret if foreign visitors came to the firm. It would be useful if youlearned a second foreign language. That would help a lot.J: I think I'd like a job like that. But I'd better go away and think about it. You see, well, after all, two more years at school is a long time, isn't it?。
Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly B Exercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved 10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being aware Exercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm 5) strength 6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C8. B Section III1) secretary 2) hard-working 3) efficient 4) private 5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening III Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw 7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.T Practice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. DPractice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. AExercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7. F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction 4) species5) oxygen 6) economic 7) conservation 8) valuable income 9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house 5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa¥tion services8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ¥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy with Section II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. BExercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by 10. sense 11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. AExercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debatePart TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particular Exercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train 13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.DExercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5,000 12. embarrassed 13. advertise the furs 14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. AExercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July 14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages EExercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking8. convenient9. restaurants 10. bathrooms Exercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winter Practice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7) A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. T Part Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. DSection III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5,7,1,4,6,3,2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship 11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conception Exercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.TPart Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause 11. fundamental 12. meaning 13. superior 14. fluently 15. read 16. exceptional 17. preparation 18. fully Section II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W 11. W 12. W 13. C 14. W 15. W 16. C 17. W 18.W Exercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic 11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slower Exercise 21. T2. F3. F4. T5.T6.F7. T8. F Listening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the strings5. manages the bowExercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. T Exercise 2Bruce Springsteen: communicative, direct, exciting, simpler Sting: naturalPeter Gabriel:musicalBranford Marsalis: brilliant, humorousYoussou N’Dour:not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.T Section II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen8. arms9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. T Exercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying 10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired 10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. T Exercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damagedExercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days8. give up9. stop trying 10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings 16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. ASection II 1. C 2. B 3. D 4.A 5. BSection III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black 11. white 12. shaking 13. wet 14. sweet 15. delicious 16. angel 17. grave 18. nights 19. days 20. taste。
Unit 1Part oneListening IInterviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela:Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian. Interviewer: That sounds complicated. Could you explain what you mean? Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home. Interviewer: Do different cultures have different ideas as to what is polite? Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person? Angela: Yes, but sometimes I don't know who I am.Exercise 1 1. F 2. F 3. T 4. F 5. T 6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silent Listening III am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you hurt, cry, or are unhappy for people you don't know, or for a movie that is not real, then I think that's a little too sensitive. That's the way I am.I am a very independent person. I must do things for myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it, because I do. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like, and would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel, or how they live, or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Exercise 1 1. sensitive/ caring independent / understanding 2. good friend 3. life people 4. learning being awareExercise 2 1. B 2. C 3. A 4. D 5. BPart Three More ListeningPractice oneTom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different. Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she hasa tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Exercise 1 1. ice-skating 2. chemistry 3. outgoing bright funny 4. moody self-centered 5. wavy blond medium height 6. unner-upExercise 2 1. T 2. F 3. T 4. F 5. F 6 TPractice twoDavid:Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl. David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you?Barbara: Thanks.David: Bye.Exercise 1 1. Four 2. Colleagues 3. Teacher 4. Susan 5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter A G IPractice Three1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 1 1. Pedro energetic 2. Mr. Miller patient 3. Mr. Smith honest 4. Jake stubborn 5. Mrs. Duke creativePractice FourA number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help. Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself. Statements1. It was easy to tell the English from the British.2. Speaking the same language helped one Australian visitor a lot.3. By "much nicer", one of the visitors meant that the British people were more friendly than people of other countries.4. The majority of continentals thought highly of English manners.5. To the young student from South Africa, Britain seemed to have a lot of foreign visitors.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 1One day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection IITom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. T aylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. T aylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window,admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything. Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. T aylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. T om, I think you'd better get on with your homework!1. B2. B3. D4. B5. D6. A7. C8. BSection II I(S1 = the first speaker; S2 = the second speaker; S3 = the third speaker; S4 = the fourth speaker)S1: In this week's edition of Up with People we went out into the streets and interviewed a number of people. We asked a question they just didn't expect. We asked them to be self-critical...to ask themselves exactly what they thought they lacked or—the other side of the coin—what virtues they had. Here is what we heard.S2: Well...I...I don't know really...it's not the sort of question you ask yourself directly. I know I'm good at my job... At least my boss considers me hard-working, conscientious, and efficient. I'm a secretary by the way. When I look at myself in a mirror as you sometimes do in the privacy of your own bedroom...or at your reflection in the shop windows as you walk up the street... Well...then I see someone a bit different. Yes...I'mdifferent in my private life. And that's probably my main fault I should say... I suppose I'm not coherent in my behavior. My office is always in order...but my flat! Well...you'd have to see it to believe it.S3: Well...I'm retired, you know. Used to be an army officer. And...I think I've kept myself...yes, I've kept myself respectable the whole of my life. I've tried to help those who depend on me. I've done my best. I am quite self-disciplined. Basically I'm a good guy, fond of my wife and family... That's me.S4: Well...when I was young I was very shy. At times I...I was very unhappy...especially when I was sent to boarding school at age seven. I didn't make close friends till later...till I was about...fifteen. Then I became quite good at being by myself. I had no one to rely on...and no one to ask for advice. That made me independent. My wife and I have two sons. We...we didn't want an only child because I felt...well I felt I'd missed a lot of things.1) secretary 2) hard-working 3) efficient 4) private 5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneListening IMart Moody from Tupper Lake used to tell this tale. "I went out one day and there was a big flock of ducks out on Tupper Lake. And I had this good dog. I shot at the ducks, and then I sent the dog out there. She was heavy with pups at the time, and I didn't know whether I should send her out there. It was a cold day in the fall. Well, she took right off and away she went. But she didn't show up when it got dark. I began to worry about her.She was a good dog, a really good retriever. She'd get anything I shot at."So the next morning I woke up and I thought I'd better go and see if I could find her. And I got down to the shoreline of the lake and I looked out. Suddenly I saw something coming. It was this dog. She came into the shore! She had three ducks in her mouth. And behind her she had seven pups. And each of the pups had a duck in his mouth." Exercise 1 1. B 2. B 3. A 4. B 5. CExercise 2 1. T 2. F 3. T 4. T 5. F 6. TListening IIThere was an old man who had a daughter. He told his daughter that he had invited a preacher to his house. He said, "Daughter, I'm going down to the train to meet the Reverend, and I've roasted two ducks and left them there for him in the other room. Don't you touch them!" The daughter said, "No, I won't touch them." So her papa went to the train to meet the Reverend, and the girl began to taste the ducks. The ducks tasted so good that she kept on tasting them until she had eaten them all up, every bit of them.After the old man came back, he didn't even look in the place where he had left the ducks. He went directly into the other room to sharpen his knife on the oilstone so he could carve the ducks. The preacher was sitting in the room with the girl. She knew that her papa was going to punish her, and she started crying and shedding tears. The preacher asked, "What is the matter with you, girl?" She said, "Papa has this one bad fault: He invites preachers to his house and goes to sharpen his knife to cut off both their ears." And the Reverend asked, "What is that you say, daughter?" The girl said, "Yes, Papainvites preachers here all the time and cuts off both their ears." The preacher said, "Daughter, hand me my hat. Quick!" The girl gave him his hat and he ran out of the door quickly. The daughter called her papa and said, "Papa, the preacher got both the ducks and has gone." The old man ran to the door and yelled to the preacher, "Hey, where are you going in such a hurry? Come back here right now!" But the preacher just kept running and shouted back over his shoulder, "Damned if you'll get either one of these." Exercise 1 1. A 2. A 3. B 4. C 5. CExercise 2 1. T 2. F 3. T 4. T 5. F 6. FListening II IJack Storm was the local barrel maker and blacksmith of Thebes, Illinois. He had a cat that stayed around his shop. The cat was the best mouse catcher in the whole country, Jack said. He kept the shop free of rats and mice. But, one day, the cat got caught in a piece of machinery and got a paw cut off. After that, he began to grow weak and thin and didn't take any interest in anything, because he wasn't getting enough to eat. So, one day, Jack decided to make a wooden paw for the cat. He made it with his pocket knife and fastened it on the injured leg. After that, the cat began to grow sleek and fat again. Jack decided to stay at the shop one night to see how the cat managed with his wooden paw.After dark, the cat got down in front of a mouse hole and waited. Pretty soon a mouse peered out cautiously. Quick as a flash the cat seized it with his good paw and knocked it on the head with his wooden one. In no time, that cat had eighteen mice piled up in front of the mouse hole.Exercise 11) stayed around 2) mouse catcher 3) rats and mice 4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat 9) managed 10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice oneKen: Hey, Josh. Where did you get those comic magazines?Josh: When I went home last weekend, I found these old Superman magazines that my older brother had bought many years ago.Ken: You don't have time to read old comics. Why did you bring them here?Josh: In my World Literature class we've been talking about the importance of myths, folk tales, and legends to cultures. We have to write a short paper on which legendary figure we think is the great American hero. I think it's Superman.Ken: Superman? Why? I think it's someone like Paul Bunyan, the giant woodsman, or Johnny Appleseed, who planted early apple trees in the Midwest. Superman is just a modern comic magazine character.Josh:When I saw these old comics, I started thinking that Superman represents a combination of cultural traditions and beliefs that have been told throughout our American history.Ken: How?Josh: Superman is an orphan who comes by rocket to Earth when his native planet explodes. He lands near a small town and is adopted by Jonathan and Martha Kent, who teach him their American middle-class values of honesty, hard work and considerationfor others. As an adult, he migrates to a large city and defends Americans against evil. Ken: What else?Josh: Well, I was thinking about this and realized that he is a symbol of the American character because he is an immigrant. We Americans have come from somewhere else, too. My great grandparents came from Germany, and I know your grandparents came from Brazil. They all worked hard and succeeded.Ken: But how does that relate to Superman?Josh: He goes to the city, just as many immigrants did, works as a newspaper reporter. But his adopted parents' values of honesty, hard work and helpfulness are a part of him. He uses his super abilities to fight dishonesty and to help the victims of crime and injustice, meanwhile working hard at his newspaper job.Ken: I understand. As an orphan, Superman becomes a new person in a new land, just as our ancestors did, and succeeds. He also represents our values. Your paper should be interesting. I'd like to read it when it's finished.Josh: OK.Exercise 1 1. B 2. A 3. A 4. C 5. DExercise 2 1. F 2. T 3. T 4. F 5.T 6 F 7. F 8.TPractice twoAt one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs instead of only for food.Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painful stiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you." The spirits of the deer would run to the place where a deer had been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If the answer was "yes", the spirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again. Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them. When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own. Finally they decided that each type of plant should provide a cure for one of the diseases which animals had caused for mankind.This was the beginning of plant medicines from nature among the Cherokee Indians a long, long time ago.Exercise 1 1. C D J 2. A E G H 3. B F IExercise 2 1. A 2 .B 3. D 4.C 5. B 6. DPractice ThreeEvery March, a flock of buzzards returns to the town of Hinkley, Ohio. No one really knows how long this event has taken place, but according to local legend the annual buzzard migration began nearly 200 years ago with a massacre."The first legend of buzzards in Hinkley, Ohio, goes back to the Great Hinkley Hunt on December 24, Christmas Eve, in 1818. The local settlers deciding that the township needed to be made safe for their livestock, gathered together about 400 men and boys, with guns and clubs and completely surrounded the township of Hinkley."As the story goes, the townsfolk began marching toward the center of town, driving all the game in front of them, and killing virtually every wild animal they encountered. "The settlers took some of the deer and the wild turkeys for the holiday dinners, but left all of the other dead animals out in the snow. When spring came, the remaining dead animals attracted many buzzards, and since 1819 they've been coming back here in March."Hinkley locals have come to appreciate the buzzards' annual return. In mid-March, on Buzzard Sunday, they celebrate the birds' arrival with costumes, exhibits and songs. Exercise 1 1. B 2. D 3. C 4. D 5. AExercise 2 1. F 2. T 3. F 4. F 5.F 6. TPractice FourAlmost seven centuries ago, in Central Asia, there lived a great king called T amerlane. He was a mighty, powerful, conquering soldier, and his greatest ambition was that one day he would rule a massive empire stretching from the Atlantic Ocean in the west to the Pacific Ocean in the east. He made his imperial capital in the oasis city of Samarkand, which he planned to make the most beautiful city on earth. Many magnificent mosques were built and they were decorated with exquisite blue ceramic tiles on the outside, and with pure gold on the inside.Tamerlane, like the great oriental king that he was, had many wives, including a Chinese girl called Bibi Khanym. Now Bibi Khanym was the most beautiful of all T amerlane's wives, and she was also the youngest. She was his favorite wife and was deeply in love with him.In order to demonstrate her great love of Tamerlane, she decided to build a magnificent mosque to honor him, while he was away fighting in a distant war. She engaged the best architect, who designed for her the most magnificent mosque you could imagine. And then she found the best master builder, who began work immediately. But as the weeks and months passed by, the master builder began to fall in love with Bibi Khanym. She resisted all his advances, but at last he threatened to leave the mosque unfinished unless she allowed him to kiss her just once. Bibi Khanym wanted the beautiful mosque finished more than anything else. She was expecting Tamerlane to return any day. So at last she agreed to let the master builder kiss her, just once.But that was her terrible mistake, for so powerful was the master builder's love for BibiKhanym that when he kissed her he left a permanent mark on her face.King Tamerlane returned and saw the guilty mark on his wife's face. The master builder was executed immediately, and then, thinking that a woman's beauty can be a dangerous thing, Tamerlane ordered that from that day on all the women in the kingdom should never be seen in public without a veil to cover their face.Exercise 1 1. B 2 . C 3. B 4. A 5. D 6. AExercise 2 1. F 2. F 3. T 4. T 5.FPart Four Testing YourselfSection 1Long long ago, there was a pretty girl named "Red Riding Hood" because she was always wearing a red hood. One day her mother asked her to take some snacks to her grandmother because her grandmother was ill. Her mother told her, "Don't hang around on your way. Don't leave the main road."On her way, she saw a wolf. The wolf asked her where she was going and she told him that she was going to her grandmother's house. The wolf thought to himself how delicious she would taste. Red Riding Hood danced in the woods, picking flowers for her grandmother and forgetting what her mother had said to her.The wolf went to the grandmother's house and ate up the poor lady. Then he waited in the bed for Red Riding Hood.As Red Riding Hood came into the grandmother's house, she found her grandmother looked rather strange with very large ears, eyes, hands and mouth. And suddenly the wolf jumped out of the bed and devoured the little girl.。
Unit 1Part OneListening IInterviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela: Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian.Interviewer: That sounds complicated. Could you explain what you mean?Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home.Interviewer: Do different cultures have different ideas as to what is polite?Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person?Angela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly 7) look at my feet8) shy and silentListening III am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you suffer and cry for people you don't know, or over a movie that’s only a story, then I think that's a little too sensitive. That's the way I am.I am also a very independent person. I must do things by myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like; and I would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell others any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BListening IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody andself-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different.Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. self-centered5. blond medium height6. runner-upExercise 21. T2. F3. T4. F5. FListening IVDavid: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you?Barbara: Thanks.David: Bye.Exercise 11. Four2. Colleagues3. Teacher4. Susan5. To go on holidayExercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter A G IFurther ListeningListening IOne day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) swearing 8) perfectly 9) wildly 10) beeListening IITom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. Taylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything.Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. Tom, I think you'd better get on with your homework!1. B2. D3. A4. A5. C6. C7. D8. C1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro C energetic2. Mr. Miller D patient3. Mr. Smith E honest4. Jake A stubborn5. Mrs. Duke F creativeExercise 21. favorite way to relax2. how to divide3. bad unripe4. stiff sore5. fastening a basketball hoopA number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) understand the Scot s’English 2) the friendliest people 3) much nicer than 4) English courtesy 5) no views on the matter/no comments on the matter。
3Unit1 听新编大学英语视听说力原文和答案Unit 1Part OneListe ning IIn terviewer: An gela, you were born in Korea but you've been living in Canada for a long time, have n't you?An gela: Yes, I was 10 years old whe n my pare nts immigrated to Can ada and「ve bee n livi ng here for 20 years now.In terviewer: Do you thi nk that bel onging to two differe nt cultures has affected your pers on ality? Angela: Yes, definitely. There are times when I think that I have two pers on alities. Depe nding on where I am and who「m with, I'm Korea n or 「m Can adia n.In terviewer: That sounds complicated. Could you expla in what you mean?An gela: Well, grow ing up in Can ada whe n I was going to high school, for example, I was known as An gela to the outside world, and asSun-Ky ung at home. I would wave hello to my teachers, but bow to my pare nts' Korea n frie nds whe n they visited our home.In terviewer: Do differe nt cultures have differe nt ideas as to what is polite?An gela: Yes, defi nitely .In high school, I was expected to look straight in the eyes of my teachers and to talk ope nly with them. But whe n Korea ns spoke to me, I was expected to look at my feet and to be shy and sile nt.In terviewer: Do you thi nk that hav ing two pers on alities makes you a richer pers on?An gela: Yes, but sometimes I don't know who I am.Exercise 11. F2. F3. T4. T5. F6. TExercise 21) outside world 2) at home 3) wave hello4) bow5) look straight in the eyes of 6) ope nly 7) look at my feet8) shy and sile ntListe ning III am a very sen sitive pers on, and that's good to a poin t. I feel every one should be able to feel or un dersta nd what others are going through. But whe n you suffer and cry for people you don't know, or over a movie that s 6nly a story, then I think that's a little too sen sitive. That's the way I am.I am also a very in depe ndent pers on. I must do things by myself. I don't like people doing things for me, or helpi ng me, or givi ng me thin gs. It's not that I don't appreciate it. I just feel that whe n some one does somethi ng for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone any thi ng.I thi nk I would be a good frie nd. I would do almost any thi ng for some one I like; and I would share orgive any thi ng I have. I'm very cari ng and understanding. People trust me with their secrets, and they're right for doing so because I n ever tell others any secret that is told to me. 「m always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good.I find fun in almost everyth ing I do (except housework). I like to watch people, talk to them, and be around them. It makes no differe nee whether I agree or disagree with what they feel or how they live or what they look like, or what age they are. I just enjoy lear ning and being aware of everyth ing and every one around me.Exercise 11. sen sitive/ cari ng in depe ndent / un dersta nding2. good friend3. life people4.learning being awareExercise 21. B2. C3. A4. D5. BListe ning IIITom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Ci ndy and I are going ice-skati ng on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for n ext week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cin dy's sister, Kristi. We could double-date. She's really outgo ing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-ce ntered. She could n't stop talk ing about how great she was. I'm not sure if I can trust you, "Mr.Matchmaker".Bill: Oh come on. So I made a mistake last time. Ci ndy's sister is really differe nt.Tom: Well, what does she look like?Bill: Ah. Looks aren't importa nt. She has a won derful pers on ality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter tha n you are.Tom: Go on.Bill: She has a great figure, a nice complexi on, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kiddi ng. By the way, she was the runn er-up in the Miss California BeautyPagea nt two years ago. Well, you're probably notin terested.Tom: No, wait!Bill: Ah, just forget I ever men ti oned it.Tom: No, I'm in terested!Exercise 11. ice-skating2. chemistry3. outgoingbright funny 4. self-ce ntered5. blond medium height6. runn er-upExercise 21. T2. F3. T4. F5. FListe ning IVDavid: Barbara, before you go, could you tell me about these stude nts that are com ing into my class?Barbara: Oh, yes. Now, let me think, well,there's…er…Paul. He's a tall, slim lad with fair hair. Very frie ndly face, lovely smile... He's particularly good with group activities, and he's a very helpfulpers on to have in the class and very helpful with the other students. He speaks flue ntly, but does make a lot of mistakes! He does n't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susa n...Susa n. Now, she's very lively, quick, and very bright. She talks all the time but not always in En glish.David: What? Is she difficult or an ythi ng? Barbara: No…she's quite young but she does behave in quite a grow n-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very ni ce. She has dark hair and dark eyes.David: Right, well…are there any other girls in the class?Barbara: Y es, there is Maria. She's Susa n's sister.David: Y es.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has Ion ger hair tha n Susan. She's not quite as bright as her sister and I thi nk that makes her feel a bit in ferior really. Well, you know, she sulks a bit whe n she gets things wrong or she misun dersta nds you. But on the whole, a very sen sible girl.David: OK.Barbara: And the n there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brow n hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determ ined to lear n as much as possible. He asks quite difficult questi ons but he does n't mean to be n asty.David: Well, tha nks, Barbara. It's all up to me now, is n't it? Have a good holiday, won't you?Barbara: Tha nks.David: Bye.Exercise 11. Four2. Colleagues3. Teacher4. Susa n5. To go on holidayExercise 21) Paul D E J 2) Susan B F 3) Maria C H 4) Peter AG IFurther Liste ningListe ning IOne day, whe n Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sen sible tha n his wife, so he started to give her a lecture on the importa nee of always remai ning calm.Fi nally he said, "It's a waste of your stre ngth to get excited about small thin gs. Train yourself to bepatie nt, like me. Now, look at the fly that has just Ian ded on my no se. Am I gett ing excited or anno yed? Am I sweari ng or wavi ng my arms around? No. I'm no t. I'm perfectly calm."Just as he had said this, Mr. Smith started shouti ng. He jumped up and bega n to wave his arms around wildly and swear terribly. He could n't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.1) upset 2) sen sible 3) lecture 4) calm 5)stre ngth6) Ianded 7) swearing 8) perfectly 9) wildly 10) beeListe ning IITom: Oh, that Mr. Taylor. He is so bori ng! Mother: What do you mean?Tom: His less ons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darli ng?Tom: Yes, he gets angry very quickly.Mother: That does n't sound like Mr. Taylor at all!Tom: And do you know, he spe nds all the time look ing at his reflecti on in the win dow, admiri ng himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And con ceited! He thinks he knows everythi ng.Mother: Oh, Tom. Be reas on able. I'm sure you're exaggerati ng. Mr. Taylor seems such a ni ce, kind man.Tom: Well, he isn't. He is mea n and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I un dersta nd. Tom, I think you'd better get on with your homework!1. B2. D3. A4. A5. C6. C7.D 8. CListe ning III1. Pedro sleeps only six hours a ni ght. He goes to school full-time and works part-time in theafter noons. At ni ght he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of pers on is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The stude nts did n't un dersta nd. He had to repeat his less on and expla in the idea more slowly. Over the next few days heexpla ined and expla ined the less on un til almost the whole class un derstood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street n eighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom.Each one saw the chair he wan ted to sit on. Unfortun ately, it was the same chair. They both sat dow n at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, the n you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of pers on is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She faste ned a basketball hoop over the wastebasket. Now the stude nts love to practice throwing their paper into the basket. When they miss, they pick the paper up and try aga in. And that was the end of the problem.What kind of person is Mrs. Duke?Exercise 11. Pedro C energetic2. Mr. MillerD patie nt3. Mr. Smith E ho nest4. Jake A stubbor n5. Mrs. Duke F creative Exercise 21. favorite way to relax2. how to divide3. bad un ripe4. stiff sore5. faste ning a basketball hoop Liste ning IVA nu mber of visitors to the UK, who had traveled throughout the British Isles, were asked by a n ewspaper reporter what their impressi ons of the British people were. Here's a brief summary of what they thought.There were many differe nt opinions among those in terviewed: Some were very flatteri ng, others very critical. The distinction between the En glish and the British was n't always un derstood, but, onthe whole, it seemed that the Scots were very popular with visitors. They were thought to be very frie ndly, eve n though one Dutch visitor con fessed she'd found it hard to un dersta nd their En glish.A great n umber found the British gen erally reserved, particularly the En glish, although one Australian visitor called the English "the frien dliest people in the world and most hospitable". But she did admit that speaking the same Ian guage was a great help.Some Asia n bus in essme n, who had traveled widely throughout En gla nd, said quite ope nly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much ni cer", one of them said, with a playful smile on his face, "By much ni cer I mea n much more like us!"A few con ti nen tals praised "En glish courtesy", but the majority found it dish on est and dull."Yo u're forever say ing 'please' and 'sorry' whe n you don't feel pleased or sorry," one expla in ed.A young stude nt from South Africa had no views on the matter. He had n't met anyEn glishme n, he said. The country appeared to be full of foreigners like himself.Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) understand the Scots' English 2) the friendliest people 3) much nicer than 4) En glish courtesy 5) no views on the matter/ nocomme nts on the matter。
Interviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela: Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian. Interviewer: That sounds complicated. Could you explain what you mean? Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home.Interviewer: Do different cultures have different ideas as to what is polite? Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person? Angela: Yes, but sometimes I don't know who I am.I am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you hurt, cry, or are unhappy for people you don't know, or for a movie that is not real, then I think that's a little too sensitive. That's the way I am.I am a very independent person. I must do things for myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it, because I do. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like, and would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. It makes no difference whether I agree or disagree with what they feel, or how they live, or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Tom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different. Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!David: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you?Barbara: Thanks.David: Bye.1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?A number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutchvisitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself. Statements:1. It was easy to tell the English from the British.2. Speaking the same language helped one Australian visitor a lot.3. By "much nicer", one of the visitors meant that the British people were more friendly than people of other countries.4. The majority of continentals thought highly of English manners.5. To the young student from South Africa, Britain seemed to have a lot of foreign visitors.One day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.Tom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. Taylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything. Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. Tom, I think you'd better get on with your homework! (S1 = the first speaker; S2 = the second speaker; S3 = the third speaker; S4 = the fourth speaker)S1: In this week's edition of Up with People we went out into the streets and interviewed a number of people. We asked a question they just didn't expect. We asked them to be self-critical...to ask themselves exactly what they thought they lacked or—the other side of the coin—what virtues they had. Here is what we heard. S2: Well...I...I don't know really...it's not the sort of question you ask yourself directly.I know I'm good at my job... At least my boss considers me hard-working, conscientious, and efficient. I'm a secretary by the way. When I look at myself in a mirror as you sometimes do in the privacy of your own bedroom...or at your reflection in the shop windows as you walk up the street... Well...then I see someone a bit different. Yes...I'm different in my private life. And that's probably my main fault I should say... I suppose I'm not coherent in my behavior. My office is always in order...but my flat! Well...you'd have to see it to believe it.S3: Well...I'm retired, you know. Used to be an army officer. And...I think I've kept myself...yes, I've kept myself respectable the whole of my life. I've tried to help those who depend on me. I've done my best. I am quite self-disciplined. Basically I'm a good guy, fond of my wife and family... That's me.S4: Well...when I was young I was very shy. At times I...I was very unhappy...especially when I was sent to boarding school at age seven. I didn't make close friends till later...till I was about...fifteen. Then I became quite good at being by myself. I had no one to rely on...and no one to ask for advice. That made me independent. My wife and I have two sons. We...we didn't want an only child because I felt...well I felt I'd missed a lot of things.Mike: Hey, guys. Come and look. I've found an interesting Web site on star signs. (The others come close to the computer and look at the star signs on the screen.) Ted: Hey, that's interesting! What's your sign, Sam?Sam: I'm a Scorpio. What's yours, Ted?Ted: I have no idea. I've never really thought about that. Let's have a look. I was born on September 5. Oh, I'm a Virgo.Simon: And I'm a Libra.Sam: What do they say about Libra, Simon?Simon: (He reads.) You're a sociable, charming person. You go out of your way to avoid confrontation and do everything in your power to make your life an easy one. Although you're generally likeable, you can be changeable, superficial and critical. But you manage to hide those traits most of the time.Mike: Do you agree with that? Are you that type of person?Simon: What do you think? I think there is something in what it says. I am social and outgoing. But I am not changeable, am I? What's your sign, Mike?Mike: I'm a Taurus. Ah, what's yours, Lilly?Lilly: I'm a Cancer.Ted: Now let's look at Taurus.( He reads.) You're a patient, practical type. Good points include your affectionate, kind nature, your trustworthiness and strength of character. Bad points include your possessiveness, self-indulgence and stubbornness. Do you think your character fits well?Mike: No, not at all. I'm not patient, and I'm not practical either. I am kind of quick-tempered and ambitious. That's definitely not me! But one thing is right: I AM stubborn.Simon: Sam, let me read yours. (He reads.) You are secretive, and sexy. You have the worst reputation in the zodiac. Scorpio has a dark side, which includes revengeful and destructive traits. Yet despite this, you can be the wittiest, kindest and most entertaining of all the signs.Sam: Oh, that can't be true! Are you sure you were reading Scorpio?Simon: Yes, of course! Look for yourself.Sam: But that's unfair! I have the worst reputation in the zodiac?!The others: (They all laugh and say.) Ha ha... Poor Sam!Sam: Who could believe such silly things! Really, I think I'm intelligent, humorous, and kind-hearted.Mike: Yes, but those are just your good traits. Don't forget about your bad ones! Sam: Come on! Oh, Lilly, we haven't looked at your sign yet. Eh, you are a Cancer, right? You want me to read yours?Lilly: No, thanks. I'm afraid you'll distort what's written there. Let me read it myself. (She reads.) To some people, you appear tough and determined, but that's just a "front" you put up to protect the real you, which is rather more sensitive and softer. You can be moody, touchy and irritable, but you make up for those negative traits with your kindness, great intuition and protective nature. That's not bad, is it? Simon: No. But what counts is not what it says, but how you really are, what you are actually like.Lilly: (She is a bit defensive.) What do you mean? What are you trying to say about me?Simon: I think you are much nicer than what it describes.(Lilly smiles.)The other boys: Oh, Simon, don't sweet-talk her! We know what you are thinking. Ted: Hey, I haven't seen mine yet. Now it's my turn.Mike: Go ahead, Ted! Be our guest!Ted: It says: Virgo people like order in all things and are neat, clean and precise in their habits. Virgo people are perfectionists and they sometimes can be critical. They do not like to draw attention to themselves. Virgo people are modest, and careful about what they eat or drink.Sam: Do you have any objections to that?Ted: I think the description matches me quite well. I AM a perfectionist. I like things to be in order. Erm, I...I'm careful about what I eat and drink. But it doesn't mention my weak points.Lilly: Oh! And what are those?Ted: Well, sometimes I'm so careful I tend to waste a lot of time. I'm not very sociable, and I don't have many friends.Sam: I think everyone has some undesirable personality traits that could be improved. Don't you think we all could improve our personalities?Mike: I think we can. For example, my little sister was the youngest girl in our family. My parents loved her very much, but they spoiled her by giving her too much. She was at that time self-centered, selfish, aggressive, bad-tempered, and rude. Her personality didn't change any until she entered primary school. In school, she first acted as she did at home, and she couldn't make a single good friend. For a time, she was even isolated by her classmates. She complained to us, and finally understood her problem. From then on, she made every effort to get rid of her undesirable characteristics both at home and in school. Now she's in middle school and has turned into a popular girl.Lilly: In my opinion, our personalities are partly inherited and partly shaped by our home environment. As we all know, scientists have found that parents' personality traits can be seen in their children. Most children have some of their parents' personality traits.Mike: That's right. And our early home and school environment also has a big influence on the shaping of our personality. For instance, I've noticed that many children growing up in rich families may become wasteful, lazy, arrogant or cold. On the other hand, I've noticed that many children raised in poor families are hard-working, caring, sympathetic, and helpful.Sam: Does that mean you think we have to choose our parents wisely?(The others laugh.)2Mart Moody from Tupper Lake used to tell this tale. "I went out one day and there was a big flock of ducks out on Tupper Lake. And I had this good dog. I shot at the ducks, and then I sent the dog out there. She was heavy with pups at the time, and I didn't know whether I should send her out there. It was a cold day in the fall. Well, she took right off and away she went. But she didn't show up when it got dark. I began to worry about her. She was a good dog, a really good retriever. She'd get anything I shot at."So the next morning I woke up and I thought I'd better go and see if I could find her. And I got down to the shoreline of the lake and I looked out. Suddenly I saw something coming. It was this dog. She came into the shore! She had three ducks in her mouth. And behind her she had seven pups. And each of the pups had a duck in his mouth."There was an old man who had a daughter. He told his daughter that he had invited a preacher to his house. He said, "Daughter, I'm going down to the train to meet the Reverend, and I've roasted two ducks and left them there for him in the other room. Don't you touch them!" The daughter said, "No, I won't touch them." So her papa went to the train to meet the Reverend, and the girl began to taste the ducks. The ducks tasted so good that she kept on tasting them until she had eaten them all up, every bit of them.After the old man came back, he didn't even look in the place where he had left the ducks. He went directly into the other room to sharpen his knife on the oilstone so he could carve the ducks. The preacher was sitting in the room with the girl. She knew that her papa was going to punish her, and she started crying and shedding tears. The preacher asked, "What is the matter with you, girl?" She said, "Papa has this one bad fault: He invites preachers to his house and goes to sharpen his knife to cut off both their ears." And the Reverend asked, "What is that you say, daughter?" The girl said, "Yes, Papa invites preachers here all the time and cuts off both their ears." The preacher said, "Daughter, hand me my hat. Quick!" The girl gave him his hat and he ran out of the door quickly. The daughter called her papa and said, "Papa, the preacher got both the ducks and has gone." The old man ran to the door and yelled to the preacher, "Hey, where are you going in such a hurry? Come back here right now!" But the preacher just kept running and shouted back over his shoulder, "Damned if you'll get either one of these."Jack Storm was the local barrel maker and blacksmith of Thebes, Illinois. He had a cat that stayed around his shop. The cat was the best mouse catcher in the whole country, Jack said. He kept the shop free of rats and mice. But, one day, the cat got caught in a piece of machinery and got a paw cut off. After that, he began to grow weak and thin and didn't take any interest in anything, because he wasn't getting enough to eat. So, one day, Jack decided to make a wooden paw for the cat. He made it with his pocket knife and fastened it on the injured leg. After that, the cat began to grow sleek and fat again. Jack decided to stay at the shop one night to see how the cat managed with his wooden paw.After dark, the cat got down in front of a mouse hole and waited. Pretty soon a mouse peered out cautiously. Quick as a flash the cat seized it with his good paw and knocked it on the head with his wooden one. In no time, that cat had eighteen mice piled up in front of the mouse hole.Ken: Hey, Josh. Where did you get those comic magazines?Josh: When I went home last weekend, I found these old Superman magazines that my older brother had bought many years ago.Ken: You don't have time to read old comics. Why did you bring them here?Josh: In my World Literature class we've been talking about the importance of myths, folk tales, and legends to cultures. We have to write a short paper on which legendary figure we think is the great American hero. I think it's Superman.Ken: Superman? Why? I think it's someone like Paul Bunyan, the giant woodsman, or Johnny Appleseed, who planted early apple trees in the Midwest. Superman is just a modern comic magazine character.Josh: When I saw these old comics, I started thinking that Superman represents a combination of cultural traditions and beliefs that have been told throughout our American history.Ken: How?Josh: Superman is an orphan who comes by rocket to Earth when his native planet explodes. He lands near a small town and is adopted by Jonathan and Martha Kent, who teach him their American middle-class values of honesty, hard work andconsideration for others. As an adult, he migrates to a large city and defends Americans against evil.Ken: What else?Josh: Well, I was thinking about this and realized that he is a symbol of the American character because he is an immigrant. We Americans have come from somewhere else, too. My great grandparents came from Germany, and I know your grandparents came from Brazil. They all worked hard and succeeded.Ken: But how does that relate to Superman?Josh: He goes to the city, just as many immigrants did, works as a newspaper reporter. But his adopted parents' values of honesty, hard work and helpfulness are a part of him. He uses his super abilities to fight dishonesty and to help the victims of crime and injustice, meanwhile working hard at his newspaper job.Ken: I understand. As an orphan, Superman becomes a new person in a new land, just as our ancestors did, and succeeds. He also represents our values. Your paper should be interesting. I'd like to read it when it's finished.Josh: OK.At one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs instead of only for food. Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painful stiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you."The spirits of the deer would run to the place where a deer had been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If the answer was "yes", the spirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again.Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them. When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own. Finally they decided that each type of plant should provide a cure for one of the diseases which animals had caused for mankind.This was the beginning of plant medicines from nature among the Cherokee Indians a long, long time ago.Every March, a flock of buzzards returns to the town of Hinkley, Ohio. No one really knows how long this event has taken place, but according to local legend the annual buzzard migration began nearly 200 years ago with a massacre."The first legend of buzzards in Hinkley, Ohio, goes back to the Great Hinkley Hunt on December 24, Christmas Eve, in 1818. The local settlers deciding that the township needed to be made safe for their livestock, gathered together about 400 men and boys, with guns and clubs and completely surrounded the township of Hinkley." As the story goes, the townsfolk began marching toward the center of town, driving all the game in front of them, and killing virtually every wild animal they encountered."The settlers took some of the deer and the wild turkeys for the holiday dinners, but left all of the other dead animals out in the snow. When spring came, the remaining dead animals attracted many buzzards, and since 1819 they've been coming back here in March."Hinkley locals have come to appreciate the buzzards' annual return. In mid-March, on Buzzard Sunday, they celebrate the birds' arrival with costumes, exhibits and songs. Almost seven centuries ago, in Central Asia, there lived a great king called Tamerlane. He was a mighty, powerful, conquering soldier, and his greatest ambition was that one day he would rule a massive empire stretching from the Atlantic Ocean in the west to the Pacific Ocean in the east. He made his imperial capital in the oasis city of Samarkand, which he planned to make the most beautiful city on earth. Many magnificent mosques were built and they were decorated with exquisite blue ceramic tiles on the outside, and with pure gold on the inside.Tamerlane, like the great oriental king that he was, had many wives, including a Chinese girl called Bibi Khanym. Now Bibi Khanym was the most beautiful of all Tamerlane's wives, and she was also the youngest. She was his favorite wife and was deeply in love with him.In order to demonstrate her great love of Tamerlane, she decided to build a magnificent mosque to honor him, while he was away fighting in a distant war. She engaged the best architect, who designed for her the most magnificent mosque you could imagine. And then she found the best master builder, who began work immediately. But as the weeks and months passed by, the master builder began to fall in love with Bibi Khanym. She resisted all his advances, but at last he threatened to leave the mosque unfinished unless she allowed him to kiss her just once. Bibi Khanym wanted the beautiful mosque finished more than anything else. She was expecting Tamerlane to return any day. So at last she agreed to let the master builder kiss her, just once.But that was her terrible mistake, for so powerful was the master builder's love for Bibi Khanym that when he kissed her he left a permanent mark on her face.King Tamerlane returned and saw the guilty mark on his wife's face. The master builder was executed immediately, and then, thinking that a woman's beauty can be a dangerous thing, Tamerlane ordered that from that day on all the women in the。