Removed_新编大学英语视听说教程3答案

新编大学英语视听说教程3答案1. A: What did you think of the movie we watched last night?B: I found it quite captivating. The storyline was unique and the acting was superb.2. A: Did you attend the lecture on climate change?B: Yes, I did. The speaker provided a lot of insightful information and raised awareness about the urgency of addressing this issue.3. A: Why did you choose to study psychology?B: I have always been fascinated by the human mind and behavior. Psychology allows me to understand and help people better.4. A: Have you read the latest novel by your favorite author?B: Not yet. I'm currently in the middle of another book, but I'm looking forward to starting it soon.5. A: How was your interview for the internship?B: It went well, I believe. I was able to showcase my skills and experiences effectively and I had a positive rapport with the interviewer.6. A: What do you think are the key factors for successful teamwork?B: I think effective communication, mutual respect, and a shared goal are crucial for successful teamwork.7. A: Did you enjoy the concert last night?B: Absolutely! The band performed exceptionally well and the atmosphere was electric.8. A: How do you manage your time effectively as a student?B: I make use of a planner and prioritize my tasks. I also try to eliminate distractions and set realistic goals for myself.9. A: What are your thoughts on the use of technology in education? B: I believe that technology enhances the learning experienceand provides opportunities for personalized and interactive learning.10. A: Have you ever traveled to any foreign countries?B: Yes, I have. I have been fortunate to visit several countries, and each experience has been eye-opening and enriching.。

Unit 1PART 1Listening 11. FFTTFT2.outside worldat homewave hellobowlook straight into the eyesopenlylook at my feetshy and silentListening II1.1.sensitive independent2.good friend3.life people4.learning being aware2.BCADBListening III1.1.ice-skating2.chemistry3.outgoing, bright, funny4.self-centered5.blond medium height6.runner-up2. TFTFFLstening IV1.1. Four2.Colleagues3.Teacher./Teaching4.Susan5. To go on holiday2.1.Paul:DEJ2. Susan: B F3. Maria: C H4. Peter: AGIPART 21.1.Mike C2Sam E3.Ted D4.Simon A5.Lilly B2.avoid confrontationgenerally likeablehide those traitsaffectionate kind nature stubbornnessworst reputationrevengeful and destructive entertainingtough and determinedintuition and protective nature perfectionistsdraw attentionPART 31.1. The lunar calendar2.Two trines3.Four trines2. who is very good with money who is easily angereddisplay the utmost amount of energy longest life and good fortunewith quick witgreat common senseinspires leadership in others seductive and charmingdeep-thinking and very talented interesting and bravePART 4Listening 1upsetsensiblelecturecalmstrengthlandedswearingperfectlywildlybeeListening II1.BDAACCDCListening III1.1 PELedro C2 Mr. Miller C3. Mr. Smith E4 Jake A5 Mrs. Duke F2.1.favorite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoop Listening IV1.FTFFT2.understand the Scots' English the friendliest peoplemuch nicer thanEngish courtesyno views on the matterUnit 2Listening I1. BABD D(最后一个答案存在疑问，应选C，请读者参考听力录音确认)2. FTTFTListening II1. AABCD2. TFTTFFListening III1.1) stayed around2)mouse catcher3)rats and mice4)got a paw5)weak and thin6)make a wooden paw7)fastened it8)grow sleek and fat9)managed10) peered out cautiously11)seized it with12) 18 miceListening IV1. BDAAC2. FTTTFTFFPART 21.1 C2 E3 D4 B5 A2. in your handused to belong topracticing withtalked to each otherwhy notask forfind a waymanage tohis own loveso foolishly jealousall three of thempeacePART 31. DCABA2.InvadesheltersupplypeacewithdrawflaghangedremembersecretsharequeenPART 4Listening 11. BCBADA2. FFTTFListening II1. 1. CDJ2.AEGH3.BFI2. ABDCBDListening IIITFFFTFTTListening IVassociatedrailroadmerchantdictionariesgrasslandsbringactionOne hundred days after his offer was made, the first herds arrived from the South.Soon there were at least 5000 cowboys bringing cattle up to Kansas from Texas.These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3Part 1Listening 11. BCDA2. FTFTFTListening II1. BDAD2. 30smale190long wavyheavily builtlight red sweaterbeardListening III1. BCAC2.lovetogethermotherhouseschoolfriendsfathermonthbeachcallListening IV1. Stories music next door in love with secretary fights3×4 √2. Celia: 1 √2 √3×4√Sara 1×2 √　2×3×4√Jack 1 √　4×Tom 1√2 √ 3√PART 211D 2C 3 B 4 E 5 A3. TFFTTTTTFFPART 31.a central bodytransport visionaccessa race trackslightly slowerhuge success2. car movementcyclingwalkingstrategiesquality of lifevisit the cityinvestmentdesignenvironmentsubtle designfocusPART 4Listening 11．FTFT2．South Americapet foodenough proteindevelopmuch moreAfricapositionnatural resourcesgone downsteadycontinued to risegetting richer and richerListening II1.the first few secondsso thinbeings from another planetfocused onlooked directly atAll arounduntil nowdespair grief and disguststarted cryingwho was sleeping peacefully6×7×8√2. 1√2 √3×4 √5√Listening IIIComplainedworkchestshockedcold-bloodedinvestigationdealingHe had mentioned his concern twice to the local officialWhenever this topic arose he always expressed strong views about drugs.ted to the murder.But it’s still early to say this is relaListening IVpovertycrimedriftbetter workresentmentattractiveeducation servicesa more positive attitudeUnit 4Part 1Listening I×,8√1 1×,2√,3×,4√,5√,6√,721)weaknesses,2) similar abilities and interest, interest you, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combinationListening II1.DDAB2.1）import from abroad 2）sales manager 3）salary 4）sales commission5) travel in 6)experience 7)university 8)on a teamListening III11)Choose their careers, 2) avoid certain careers3) different professions, 4) impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance 2 TFTFTListening IV1.C A C B D2.1)occupation cool2)catch provide fulfilling3)media coming after you make your own work schedule4)have my pick of jobsPart 2×K√L√1. A√B√Ｃ×D√Ｅ×F√G×H√I√Ｊ2 1) computer engineering, 2) computer programmer, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical research, 9) management, 10) 3600Part 31.A√Ｂ×C√D√Ｅ×F√Ｇ×H√2.1)tremendous element of care, what kinds of contributions2)where you’re from3)professional learning, colleagues, peers4)what makes their students tick5)relaxed, care about them, passionate, developPart 4Listening I1)100 million2)35, 403)seven, eight4)office workers, many professionals5)8:00, 4:006)eight-hour shifts7)Monday, Thursday, Saturdays, Sundays8) choose their own working hours, freedom of choice, happy withListening II1.ADCADListening IIICBDCAListening IV1. CABDB2.1) ADF2)BF3)ACEUnit 5:Part 1：Listening 1:1.1.plays, real people real life, emotional, problem, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kind2. F F T T T TListening II:1. 1 C 2 A 3 D2.1.be understood easily2.necessary desirable3.splendid4.prevents, from achieving5.anxiety, effectListening III:1.1.T2. F3. F4. F5.T6.T21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IV:11. C2. C3. A4. B21.eggs, toast2.realistic, far better than, forgetting3.determined, personality culture4.recite aloudPart 2：1．1-B 2-A 3-C 4-E 5-D 6-F2.1.over long distances2.look into it3.five times4.individual group5.sex-specific males females strangers6.great apes7.teach own kind8.raised held look bigger9.round tail-wagging10.feeding every directionPart 31.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.Johned joined6.Siji…Siji Delaney Sinjin Delaney7.Awful lawful8.Spigot spiritPart 4Listening 11.Economic2.religions3.exist4.biologically5.40,0006.cave7.Written8.humans were probably speaking thousands of years before that9.Even while we are reading or just thinking, we are in a sense“talking”nguage is so much a part of human existence that we will betalking as long as we inhabit the Earth.Listening II1. D A B B A2.1.Permission apply for2.application form website3.regular mail faxcredit cards4.traveler’s checksListening III1A×B√ C √D×E√21)Other native languages2)two3)more4)of their choice5)Spanish6)Indians7)English German FrenchListening IV1.1.learner teacher curriculum2.Curiosity expectations goals2.T F T F TUnit 6PART 1Listening I1. BCDB2. TFFFTFLstening II1.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACALisening III1.CABD2.1.crowding war water grass2.what is happening keep the number of horses low3.target practice where the horses were found4.gotten rid of stayListening IV1. FTFTFTFF2. 1×2×3×4√　5× 6 √PART 21.DABCCA2.1.farm animals hold feed2.small pets toys3.bury toss them out4. real shame5.dangerous destructive bring diseases6.have a point7.humanely limit8.time money warm place9.isolated company10.storm of debatePART 31.ADDBACAB2.1. female collectively2. not a moment3.infinite care4.picks up keft to right5.stuck smarter6.salt water lake dock7.self-aware non-human intelligence belong in captivityPART 4Listening 11.1√ 2×3×4√ 5√ 6√ 7 √ 82.ACCADLstening II1. CBDDA2. 1×2√ 3×4×5√ 6×7√ 8×Lstening III1CADBB2.1.family holiday2.7-foot 18 stones3.stroking adjusting his clothing4.fractured skull black eye broken arm5.lose his love6.cat7.get-well cards presentsLisrening IV1.1）a.whales and dolphinsb.birdsc. tigers2）a. meat oilb.handbags shoesc.furd.ivory2.TFTT。

UNIT1 Outside view Activity 1 Keys:3-5-4-1-2 Activity 2 BCCAA Activity3Activity41-H 2-C 3-B 4-F 5-D 6-A 7-E 8-G Activity5不用写News reportActivity 1ADActivity 2DBPassage 1Activity 1CDABActivity 21. (1) tolerant (2) rounded2 (1) close to (2) stand up3 (1) beauty (2) generosity.4. (1) an opportunity (2) beyond the one5 (1) behaved (2) selfish6. (1) pretend (2)see through7. (1) helping victims (2) impact8. (1) difficult time (2) a huge amount ofPassage2Activity 11-D 2-B 3-E 4-A 5-CActivity 21.(1) strengths (2) weaknesses (3) personality(4) like (5) subjects (6) organized (7) confident (8) outgoing (9) a team (10) working alone2.(1) future career(2) into a particular area of work(3) chosen field(4) related industries(5) leading3.(1) vocational (2) graduates (3) high-flyers(4)career (5)practical(6)transferable (7) recruitment UNIT TEXTCABDB CDB CAB DBDUNIT2Outside viewActivity 14-6-2-1-5-3Activity 2(1)where there is war(2)go to school(3)157 countries / one hundred and fifty sevencountries / one hundred and fifty-seven countries(4)never known peace(5)bringing medicine(6)get an education(7)40000 kids(8)not allowed(9)50 / fifty(10)running the schoolActivity3Activity4 DABBA News report Activity 1ACActivity 2DB Passage 1 Activity 1(1)husband(2)a church(3)favourite(4)a farm(5)2(6)14(7)40 Activity 2 CBACDA Passage2 Activity 1 KEVIN:1,3,7EVA:2,4,5,6Activity 2(1)looking forward(2)apart from(3)on(4)used to get very cross(5)angel(6)pretty sad(7)some cashUNIT TEXTACBDB BAC BCD ABC UNIT3Outside viewActivity 11,5,9,10Activity 2(1)painting(2)broke all the rules(3)looking directly at(4)a sense of movement(5)indicated(6)trying to say(7)covered up(8)subject(9)seemed happier(10)mystery(11)line up between(12)tell a story Activity3Activity4(1)stories(2)essence(3)exposure(4)reflections(5)a string(6)capture(7)decayNews report Activity 1CBActivity 2CAPassage 1Activity 1(1)highlight(2)live(3)percussion(4)1997(5)Performance(6)Kitchen(7)Instruments(8)random drumming Activity 22,4,7Passage2Activity 1(1)London(2)1929(3)Free(4)1(5)2Activity 2ACDCBUNIT TEXT BADAC DAC DBA ACB UNIT4Outside view Activity 17-3-5-2-6-4-1 Activity 2(1)as many(2)Lots of(3)use local materials(4)roofs(5)castleActivity3(1)houses or flats(2)a few houses(3)Sixty / 60(4)detached houses(5)different(6)in age(7)thatched cottages(8)spend(9)castleNews report Activity 1DAActivity 2BCPassage 1 Activity 1(1)nine(2)30s(3)more than(4)rough(5)male(6)50Activity 2(1)next spring(2)hospitals(3)4(4)three quarters / 3 quarters(5)Charities(6)family or friendsPassage2Activity 1Man:2,3,6,7,9Woman:1,4,5,8Activity 2DABADUNIT TEXTDBACD ABC BCA DCDUNIT5Outside viewActivity 1不用写Activity 2BCDAActivity3不用写Activity42-10-13-3-7-8-1-9-11-14-5-6-12-4News reportActivity 1DCActivity 2DBPassage 1Activity 1(1)effective(2)groups(3)30s(4)Increases(5)factors(6)Identity(7)individual performance(8)60s(9)Group(10)Forming(11)get to know(12)ideas and creative energy(13)identity(14)Performing(15)togetherActivity 21-C 2-A 3-E 4-G 5-F 6-D 7-H 8-B Passage2Activity 1CBCCAActivity 2(1)250(2)36(3)2(4)30UNIT TEXTCDBDA DAC BAC ABCUNIT6Outside viewActivity 11.lunar2.happiness .3.(1) bamboo (2) blossoms4.(1) happiness (2) togetherness (3) strong5.longActivity 21. exact date2. lasts for3 send out4. the coming year .5. red envelopes6. cleaning7. flowers8. (1) togetherness (2) happiness Activity31. generous2. South Korea3. family setting .4. get your own plate5. (1) Asian (2) Americans6.American kids7. customsActivity4CCACCDActivity5不用写News reportActivity 1CCActivity 2BDPassage 1 Activity 12,5,6Activity 2(1)making a guy(2)burn him(3)17th(4)Parliament(5)Light(6)which they did(7)no reason(8)started building Passage2 Activity 1 Christmas:1,6,8 Thanksgiving:2,3,7 Hogmanay:4,5 Activity 2(1)religious(2)get together(3)Father Christmas(4)give thanks(5)Thanksgiving(6)shortestUNIT TEXTBACCD BCA CDA ACC UNIT7Outside viewActivity 11,2,5Activity 2BCABDActivity3(1)cycling(2)something good(3)sit on(4)two legs(5)life on the road(6)throw(7)different(8)performing marvellously News reportActivity 1DBAActivity 2BCPassage 1Activity 1(1)New York(2)155(3)30(4)0(5)57Activity 2(1)few(2)catch fire(3)made a successful(4)taking in water(5)into the boats(6)taken to hospitals(7)as a hero(8)without any engines Passage2Activity 11.zoo keeper2.Al Gore3.making people take climate change seriously4.Greenpeace5.part-time accountant6.Melinda Gates7.co-founding the Bill and Melinda Gates Foundation8.Save the ChildrenActivity 2ABBACUNIT TEXTADBDC ABD CBD ABCUNIT8Outside viewActivity 11,3,4Activity 2AAAABBActivity31. (1) gravity reduction (2) Noah's ark2. gravity reduction3. (1) hoax (2) trueActivity4(1)famous hoax(2)in front of(3)floating(4)destroyed by a flood(5)believed to be(6)announced(7)on the top of(8)may or may not be(9)believe themNews reportActivity 1CCBActivity 2BAPassage 1Activity 1Japanese:godsJewish / Christian religion:eternal darkness,eternal water / ocean,a single creatorAncient Finns:an animal,a cosmic eggnative tribes of New Zealand:godsIslamic religion:a single creator the Apache:eternal darkness Inuit people:an anim Africans:an animActivity 21.the huge differences2.there was only darkness3.there was light4.a small island5.united to create6.the world emerges from it7.the sun8.creation myth at all Passage2BCDBDUNIT TEXTDCBAD BDC ACB ACC。

New Standard College English (Book 3) Unit 1Inside ViewConversation 1Exercise 11 Janet is a Chinese student in England.2 She studies at the University of Oxford.3 She is in London.4 Probably she is visiting her friends or doing a tour around London.5 I can see Tower Bridge and the Houses of Parliament.6 She is talking to her friends.Exercise 21 Janet is not going back home to China. (Because she wants to work in London during the long summer holiday and find out what it’s lik e to live in this busy and lively city.)2 It is in the middle of summer.3 Janet is going to work for London Time Off, a website about London.4 Joe is Janet’s boss.5 Janet doesn’t know what she is going to do.(Because it is her first day working there.)6 Joe and Andy do not agree that New York is the greatest city. (Andy thinks London is.)Exercise 3Exercise 41 Janet wants to find out what the busy and lively city of London is like.2 Today.3 Joe doesn’t agree with Andy. (But they argue in a joking way.)4 It is not as great a city as London.5 She thinks London is probably the greatest city in the world.Conversation 2Exercise 55-6-2-3-8-7-4-1Exercise 61 don’t mind my asking2 He drives me crazy3 What do you mean by4 It’s the last thing5 we check out new events6 the musicians or the actors7 Can I ask you something else8 we’ve got an interview to do9 supposed to be on his wayEveryday English1 (b)2 (b)3 (b)4 (a)5 (a)6 (b)Outside ViewExercise 24-5-1-3-2Exercise 31 (b)2 (c)3 (c)4 (a)5 (a)Exercise 51 Bjoern (b), (d), (f)2 Wolfgang (a), (e)3 Pascal (g)4 Yosma (c)Exercise 61 So that they can learn something about themselves2 It can lead to a higher self-consciousness.3 It can lead to happiness.4 A strengthening of the personality.5 “Who am I as a person? Am I really happy?”6 He thinks students can get indications of happiness from teachers.7 Happiness scientists.8 They don’t write definitions on the board.Listening inExercise 21 (c)2 (d)3 (a)4 (b)Exercise 31 tolerant; rounded2 close to; stand up3 beauty; generosity4 an opportunity; beyond the one5 behaved; selfish6 pretend; see through7 arrived in; had to help8 difficult time; a huge amount ofExercise 61 Joan is an academic counselor at Manchester University.2 She is talking to a presenter and callers for a radio program.3 It is important, because their choices of subject are likely to have an impact on their future careers.4 He wants to work in IT.5 Not at all. (In Britain each university has a different mixture of courses; some courses can only be found in a few universities.)Exercise 71 strengths; weaknesses; personality; like; subjects; organized; confident; outgoing; a team; working alone2 future careers; into a particular area of work; chosen field; related industries; leading3 vocational; graduates; high-flyers; career; practical; transferable; recruitment Unit 2Inside ViewConversation 1Exercise 2The true statements are: 2, 3 and 5.1 Andy mentions the names of two bridges, not one.4 Andy saw it go up when he was a child.6 It is one of the cleanest city rivers today, although it was very polluted in the past.Exercise 31 In Southwark, which is part of London2 About 120 years old3 It used to be raised three or four times a day4 not so often5 In the late 1980s and 1990s6 In the 1960sExercise 41 She’s really impressed.2 Because they couldn’t go under London Bridge.3 Just on this side of London Bridge.4 He remembers that many buildings were damaged from the war.5 They used to take you to the hospital because the water was so polluted.6 It is one of the cleanest city rivers in the world.Conversation 2Exercise 61-(b) 2-(b) 3-(b) 4-(d) 5-(d) 6-(a)Exercise 71 The thing about2 It’s amazing3 Let me see4 Anyway where was I5 You were telling me about6 That’s fascinating7 Let me thinkEveryday English1-(b) 2-(a) 3-(b) 4-(b) 5-(b)Outside ViewExercise 24-3-6-1-5-2Exercise 31 where there is war2 go to school3 working in 157 countries4 has never known peace5 bringing medicine6 get an education7 40,000 kids8 girls were not allowed9 50 per cent10 the mystery about her for 12 yearsExercise 41 (d), (g)2 (e)3 (c)4 (f)5 (a)6 (b)Exercise 51 (d)2 (a)3 (b)4 (b)5 (a)Listening inExercise 21 her husband2 a church in the distance3 her favourite aunt (and uncle)4 a farm5 two (the speaker and her brother)6 about 147 20 yearsExercise 31 (c)2 (b)3 (a)4 (c)5 (d)6 (a)Exercise 63-5-1-4-6-2Exercise 7Exercise 81 Because he thought it would make him grown-up.2 Because he was lying on the floor screaming and screaming.3 Because she wanted to go home and she couldn’t get her coat on.4 Because they used to fight (but actually, they’re just having fun).5 Because she had short blond hair.6 Because she had had some good times.7 Because he wanted to get a job and earn money.Unit 3Inside ViewConversation 1Exercise 21. He used to work in a theatre.2. He moved the scenery between the acts in the play.3. She saw My Fair Lady.4. To find out where Andy and Janet are … or to check if they are going to be late.5. He’s a theatre critic.6. She has to check the sound level.Exercise 3Exercise 4True statements are 2, 3, 4 and 5.Conversation 2Exercise 61 (b)2 (c)3 (d)4 (c)5 (a)Exercise 71. has just been to see2 Can you tell me something about it3 Tell me more about4 It sounds very unusual5 So it’s family entertainment6 did I do something wrong7 Did you remember to8 Hurry upExercise 81-6bbaaaaOutside ViewExercise 2The true statements are: 1, 5, 7, 9 and 10.Exercise 31 the most famous2 broke all the rules3 looking directly at4 a sense of movement5 indicated a real place6 what is she trying to say7 covered up one side of her face8 we’re the subject9 seemed happier10 the mystery about her11 line up between12 tell a storyExercise 4Exercise 51 Her portraits and books both tell stories.2 The character or performer of the images.3 She is trying to capture a deeper essence of a person.4 He uses a pinhole camera which requires a very long exposure.5 She needs to work on the reflections in the water and the face of the boy.6 He links them together with a string.7 She tries to capture something about the soul, or essence, of the person.8 It represents the process of decay.Listening inExercise 21 The highlight was seeing the show Nanta.2 It’s a live show: part theatre, part dance, part music.3 The music is a mixture of traditional Korean music, percussion and drums.4 In 1997.5 Because it’s a non-verbal performance.6 It’s set in a kitchen.7 They use knives, dustbin lids and kitchen utensils.8 Nanta means “random drumming” in Korean.Exercise 3The true statements are: 2, 4 and 7.1 Nanta is a mixture of traditional Korean with a Western style performance.3 They are preparing food for a wedding reception.5 They give cooking lessons to the manager’s nephew, not to the manager.6 They are totally involved but they don’t throw food.8 They have already appearedat the Edinburgh Festival.Exercise 6Exercise 71 (a)2 (c)3 (d)4 (c)5 (b)Unit 4Inside viewExercise 21 They’re preparing to interview Janet’s friend.2 The interview is part of a background series to ethnicrestaurants.3 The London Video Games Festival in Trafalgar Square.4 It’s very popular. About 100,000 people attended last year.5 They put up a huge tent where people6 Because it’s very popular.Exercise 31-5 bdabbExercise 61 The rise of e-book readers.2 That you’ll never run ou t of things to read.3 He complains that someone is using a mobile phone and he is picking up the signal in the other studio.4 She feels that she keeps making a mess of things.5 A report on how technology is changing so fast.6 Because Joe started the recording before Andy had time to adjust the sound level. Exercise 71 They’re not really like2 But the trouble is3 the great thing about them is4 there is nothing quite like5 more text messages than6 it’s my fault7 Just ignore himOutside viewExercise 21-6 bcbcddExercise 31 wax and feathers2 got off the ground3 thrust, lift and control4 Thrust5 the tail6 provide lift, control and thrust, and be light enoughExercise 45-3-2-6Exercise 51 inventions2 develop and test3 helped them understand and study4 the shapes of different wings5 made the front steady6 controllable7 distance and duration8 1000 test flight9 flew the first powered airplaneListening inExercise 21 Work in office-based jobs.2 People are not exercising their bodies and they are putting on weight.3 It is caused by long periods spent sitting at the computer.4 They ensure staff are sitting correctly at their computers and take breaks.5 It is caused by several factors: lack of natural air and light, having a lot of electronic devices and air-conditioning.6 They are installing better lighting and ventilation,increasing the number of plants and encouragingemployees to take breaks.Exercise31 18 per cent2 over 40 per cent3 a/one fifth (20 per cent)4 over a million5 roughly 30 per centExercise 6The true statements are 2, 7 and 8Exercise 71 the amount of the world’s farmland that ismanaged intensively2 the proportion of flowering plants that need to be pollinated in order to bear fruit3 the number of commercially grown crops that need honey bees4 the number of bees released by farmers in California to pollinate almond trees5 the time for a species of wild mango to bear fruit6 the time for a cultivated species of mango to bear fruitUnit 5Inside ViewExercise 21. It is Cantonese food.2. Indian and Chinese restaurants.3. They want to know about life in Chinatown and a bit of background and history.4. There are very few who actually live there.5. It’s much smaller.6. There are only three or four streets.Exercise 31. (d)2. (g) 3 (f) 4 (a) 5 (b) 6 (c) 7 (e)Exercise 5□1 So where do you call home?☐ When did your family move to London?□3 And how did they make their living?☐ Did your grandparents work in Chinatown too?□2 So how long has there been a Chinese communityin London?□4 And why did Chinatown move over here?☐ Can most British-born Chinese speak Chinese?□5 And does it still feel like a traditional Chinesecommunity?☐ How do you celebrate Chinese New Year in London?☐ Which is the best Chinese restaurant in Chinatown?Exercise 61 (d)2 (b)3 (c)4 (b)5 (a)Exercise 7(1) I guess this is home(2) how long has there been(3) When the Chinese first came to(4) they were also famous for(5) At the start of the 20th century(6) from all over London(7) And does it still feel like(8) along with the ChineseEveryday EnglishExercise 81 (b)2 (b)3 (a)4 (b)5 (b)Outside ViewExercise 21. It’s peaceful and quiet and just the place to relax.2. They fight.3. During the mating season.4. When they’re on a crowded street or bus.5. She’d be very angry and tell them to move.6. Maybe throw a little sand in their face and make them move.7. Move his towel next to them and start a conversation.8. People can get a lot more aggressive.9. She’s waiting until someone wants her parking space. Exercise 31 (b)2 (c)3 (c)4 (d)5 (a)Exercise 51. He pulls into the parking space that the producer left.2. Because he was waiting first.3. Anger management counselling.4. Because the radio is on.5. A hearing problem.6. He would beep the horn, roll down the window and shout very rude things at the person who took the space.7. She would yell out of the window and tell them to move.8. It is important for survival.Exercise 67-1-4-8-2-9-13-3-10Listening InExercise 2•synergy: performance of effective groups > sum of individuals.•1930s Elt on Mayo discovered “Hawthorne effect”:* Being in a study improves productivity regardless of other factors.* Personal identity, self-esteem and social context in which group works improve performance.• 1960s Tuckman described stages of a group.* 1 Forming: Individuals get to know each other.* 2 Storming: Individuals share ideas and creative energy.* 3 Norming: Group identity forms.* 4 Performing: Group works together.Exercise 31 (c)2 (a)3 (e)4 (g)5 (f)6 (d)7 (h)8 (b)Exercise 61 (c)2 (b)3 (c)4 (c)5 (a)Exercise 71. Over 250 people died.2. 36 new homes were rebuilt.3. It is two square metres.4. 30 per cent of the cost of the building or rebuilding their home is needed.Unit 6Inside ViewExercise 21. She thinks it’s old.2. Wood.3. A thatched roof.4. A kind of dried grass.5. They stand.6. A report on the summer season at the Globe. (As schools have terms, theatres have seasons.)7. Stratford-upon-Avon.Exercise 31. 19972. 16663. There are some seats but most people stand.4. May.5. About 130 kilometers.Exercise 41 (d)2 (b)3 (c)4 (a)5 (c) Exercise 6The true statements are: 1, 3, 4, 5 and 9. Exercise 7(1) when was Shakespeare born(2) when did he die(3) when did he come to London(4) don’t know exactly(5) what happened to him later(6) I reckon there are about(7) What I think is(8) I suppose it’s because(9) I’m really stunned(10) I guessExercise 81 (b)2 (a)3 (a)4 (b)Outside ViewExercise 2The true statements are: 1, 2 and 5.Exercise 31 (b)2 (c)3 (a)4 (b)5 (d) Exercise 4(1) I don’t like cycling(2) do something good(3) sit on a couch(4) and with two legs(5) life on the road(6) throw the bike(7) It’s been d ifferent(8) performing marvellouslyListening InExercise 21. New York2. afternoon3. 1554. 30 to 45 seconds5. none6. 577. 29Exercise 31. there were few injuries2. catch fire3. made a successful landing4. taking in water5. helped into the boats6. were taken to hospitals7. as a hero8. without any enginesExercise 6Paul1. zoo keeper2. Al Gore3. making people take climate change seriously4. GreenpeaceClare5. mum, part-time accountant6. Melinda Gates7. co-founding the Bill and Melinda Gates Foundation8. Save the ChildrenExercise 7The true statements are: 1, 5 and 7.Unit 7Inside viewExercise 25-3-2-6-1-4Exercise 31 (c)2 (d)3 (d)4 (a)5 (b)6 (b) Exercise 51 It’s got everything to do w ith science.2 She thinks it sounds fascinating.3 At the museum4 She tells him Andy and she are going to spendthe night together.5 Joe is surprised and confused.Exercise 61 Why is it so special2 I suppose this is3 have special exhibitions for kids4 The first thing you have to do5 we’re really gonna stay the night6 While you’re getting7 where are you two off toExercise 71-5 bbbabOutside viewExercise 3Uses of computers include: to provide travel updates, to operate trains, to analyze evidence, to control buildings, to switch on lights, to provide entertainment, to control the temperature and to close blinds.Places where computers are used include: homes, police stations, libraries and schools.Exercise 41 (a)2 (d)3 (c)4 (a)5 (d)Exercise 51 areas of life2 in our homes3 computer-controlled houses4 adjust the temperature5 give new instructions6 react to match7 TV and Internet8 outside changes9 stop too much sun from entering10 turn the oven onListening inExercise 21 Scientists at the University of Bristol carried out a two-month study to find the best way to dunk a biscuit.2 About one in four biscuits break up when dunked.3 Unlike biscuits, doughnuts are held together by protein gluten which doesn’t break down in hot liquids.4 Horizontally dunking a biscuit into tea allows a longer dunking time, as the liquid takes longer to soak into it.5 The hotter the tea the faster the biscuit breaks up.6 Dunking a biscuit in a hot drink releases up to ten times more flavour than eating the biscuit dry.Exercise 31 dunking biscuits2 held together3 absorb liquid4 travel through5 hold the biscuit6 producing a tableExercise 6The statements said by Peter are: 1, 2, 4, 6 and 8.The statements said by Louise are: 3, 5 and 7.Exercise 71 (b)2 (b)3 (d)4 (a)5 (c)6 (a)Unit 8Inside ViewExercise 21. Most weekends.2. Every day of the week. / All week.3. 10 am to 6 pm.4. It gets pretty lively as people go to the pubs and restaurants all around.5. They sell pretty well everything.6. It’s a famous club. / It’s one of THE great clubs in London.7. To the Electric Ballroom.8. No, she doesn’t.Exercise 3The statements said by Janet are: 4 and 8.The statements said by Andy are : 3, 6 and 7.The statements said by Joe are: 1, 2 and 5.Exercise 51 (c)2 (c)3 (d)4 (d)5 (c) 6(b)Exercise 6(1) to be having fun in London(2) wearing these amazing costumes(3) attracts about two million people(4) It takes place(5) the usual time(6) It’s a festival which takes place(7) for the rest of the year(8) It starts in half an hourExercise 71 (a)2 (a)3 (b)4 (b)5 (b)Outside ViewExercise 21. The lunar calendar.2. Red means happiness.3. Flower arrangements which include pine branches, bamboo and blossoms.4. Oranges and tangerines mean happiness, coconuts represent togetherness and lychee nuts represent strong family ties.5. Noodles represent long life.Exercise 31. so the exact date2. lasts for 15 days3. to send out the old year4. for the coming year5. red envelopes of money6. cleaning the house completely7. flowers will turn into fruit8. A whole fish9. during this holidayExercise 41. they’re very generous2. South Korea3. a family setting4. get your own plate; dig in together5. Asian; Americans6. American kids7. what customs they like8. KoreaExercise 51 (c)2 (c)3 (a)4 (c)5 (c)6 (d)Listening InExercise 2The true statements are: 2, 5 and 6.Exercise 31. making a guy2. burn him3. start of the 17th century4. beneath Parliament5. he was trying to light6. which they did7. no reason8. started buildingExercise 71.Because it’s a religious festiv al but she is not a religious person and so it doesn’t have that kind of meaning to her.2. It’s a good reason for families to get together, eat a lot of good food and give each other presents.3. Because it’s exciting to think that Father Christmas wil l come down the chimney and leave them presents.4. It’s a time to give thanks for everything you have.5. He says it’s probably as commercialized as Christmas.6. The shortest day of the year.Unit 9Inside viewConversation 11. Example answers1. The three friends are standing by the bar in a pub, probably discussing what to order. The barman is possibly filling a glass or standing ready for their decision.2. Probably not. She may in fact be asking for advice as the situation is an unfamiliar one.3. I am a bit puzzled---- bars usually have more exciting names. The Duke of York sounds odd, but perhaps it is a very old pub.4. It could be something to do with history or perhaps such names are memorable and are good for business.2 AnswersThe true statements are: 2and 5.3. Answers1(b) 2(c) 3(d) 4(c) 5(d)4. Example answers1. They look attractive and are memorable, and also they come from a time when fewer people could read easily.2. They could get their names from the people the first owners liked or wanted to please, features of the building, or they could be references to the location.3. They illustrate the name.5. Answers5-places 2-animals1-royalty or landowners 7-myths and legends4- objects 6- jobs3-symbols taken from the Bible6. Answers(1) where was I (what was I saying before)(2) You sound as if you know something about(3) where did I leave off (finish speaking)(4) OK, got you(5) and let me see(let me think)(6) My mind’s g one blank (I cannot recall for a moment)(7) if you’ll excuse me(8) It was great talking to you7. Answers1(b) 2(a) 3(a) 4(a) 5(b) 6(b)Outside view1 Example answers1. It’s the British Royal Family. There’s the Queen and her husband. And look, aren’t these William and Harry? The main Royal Family starts fourth from the left with Prince William and his younger brother, Prince Harry. Slightly to the back, behind her mother, stands Princess Anne, the Princess Royal. The Queen stands next, waving. The lady in white is the countess of Wessex, with just in front of her, her husband, Prince Edward. He is looking over the shoulder of her father, Prince Philip, the Duke of Edinburgh. The tall gentleman in uniform is the Princess Royal’s husband, Rear Admiral Laurence. The Duchess of Cornwall in blue stands next to her husband, Prince Charles, Prince pf Wales.2. They are royal.3. Your Majesty, I think for the Queen, for the first exchange and after that Ma’am. For princes Your Highness and after that, sir.4. Well, they are normal human beings but they live in palaces.5. The jewels would be nice but all the ceremony must be dull and the lack of privacy cannot be nice as princess Diana knew so well.2. AnswersPhoto 1: ElizabethPhoto 2: JamesPhoto 3: GeorgePhoto 4: Victoria3. Answers1. It’s used to refer to princes and princesses.2. It’s used to refer to the Queen.3. The German sounding name used by the Royal Family before.4. Te Royal Family’s popular family castle.5. The Royal Family’s sur name after 1960.6. At the wedding, Charles was recorded in the marriage register as His Royal Highness Prince Charles Philip Arthur George, The Prince of Wales.7. Popular names for royals.4. Answers1(b) 2(b) 3(d) 4(a) 5(b) 6(c)Listening in2. answers2-6-5-3-1-43. Answers4. Answers1. attractive, powerful: attractive, powerful2. to think of3. much too long4. meaning very small5. the best or the strongest6. most romantic lovers7. sound luxurious6. Example answers1. It seems to be about how names sound in different languages and changing your name when you get married.2. Clare is a gir l’s name and men do not change their name on marriage so it’sa woman speaking.3. Greek.7. AnswersThe true statements are: 3, 4and 6.8. Answers1.(c)2. (b)3. (c)4. (a)5. (d)Unit 10Inside view1. Walking2. She doesn’t know anything about London.3. Some existed; some did not.4. To have come to London with his cat to seek his fortune.5. He was Lord Mayor of London four times.6. We have no proof that he had a cat.7. The ghosts of London.4. Example answers1. They all look very pleased so they must be praising her.2. I think all the interesting places they have seen must have been pleased her.3. Perhaps working with Andy.4. Yes, I think they have a special relationship.5. Answers1(b) 2(a) 3(b) 4(d) 5(c)6. Answers1. Way to go2. That’s the way to do it3. Let’s hear it4. Good for you5. Thank you so much for your help6. couldn’t have done it7. we certainly did8. It’s extraordinary9. So what’s next7. answers1(b) 2(a) 3(b) 4(b) 5(a)Outside view2. AnswersThe true statements are: 1,3and43. Answers1. in the present2. to trick people3. got sunscreen in his eyes4. eating bananas5. were descended from apes6. humans and animals4. Answers1. The Gravity reduction story and the Noah’s Ark sto ry.2. The Gravity reduction story.3. The Gravity reduction story was a hoax; the Noah’s Ark is true (because something has been spotted.)5. Answers1. is based on a famous hoax2. would pass in front of3. at that moment4. the world was destroyed by a flood5. It is believed to be6. announced on the radio7. snow on the top of8. may or may not be Noah’s Ark9. we want to believe themListening in2. Answers1(d) 2(a), (b),(c) 3(e), (f) 4(d) 5(c) 6(a) 7(e) 8(e)3. Answers1. the huge differences2. there was only darkness3. there was light4. a small island5. Mother Earth6. a bird7. the sun, and the earth8. creation myth at all6. AnswersCallers 1,3,4 and 5 believe in big cats.7. Answers1(b) 2(c) 3(d) 4(b) 5(d)。

大学英语教材视听说3答案Unit 1: 家庭生活Listening ComprehensionPart 1: Short Dialogues1. A) She has a lot of work to do. B) She has to take care of her sick grandmother.2. A) He didn't watch the TV show. B) He thinks the TV show is boring.3. A) He's reading a book. B) He likes reading books in the library.4. A) At a restaurant. B) They ate a meal.5. A) She doesn't like her new job. B) The job is too difficult for her.Part 2: Long Dialogue6. A) She is too busy with her coursework. B) She hasn't had any time to relax.7. A) It's at the city center. B) It is very convenient for everyone.8. A) She has lived there for two years. B) She thinks the neighborhood is safe.9. A) They were talking about their plans for the weekend. B) They decided to go hiking in the mountains.10. A) She is not good at sports. B) She prefers reading books instead.Part 3: Passages11. B) The importance of a healthy diet.12. C) The benefits of regular exercise.13. A) The negative effects of stress on health.14. B) The importance of a good night's sleep.15. C) The significance of maintaining good mental health.SpeakingPart 1: Personal Experience1. I often communicate with my family members through video calls or texting apps.2. Yes, it is. It helps me to save time and money, especially when I cannot meet them in person.3. I try to schedule regular family gatherings or plan trips together to maintain the bond.4. Yes, I think it is important to have regular communication with family members no matter how busy we are.Part 2: Expressing Opinions1. Personally, I prefer traveling with friends because we can share the excitement and create memories together.2. I think studying in a group is more effective because we can learn from each other and help each other with difficult concepts.3. In my opinion, participating in extracurricular activities is beneficial as it helps to develop various skills and make new friends.Part 3: Describing Pictures1. The picture shows two friends having a picnic in a park. They are sitting on a blanket and enjoying their meal.2. The picture depicts a group of students studying together in a library. They are reading books and discussing the lessons.3. The picture illustrates a person doing yoga in a peaceful setting, surrounded by nature. They are in a meditative posture.Part 4: Role PlayA: Can you recommend a good restaurant near here?B: Sure! There's a famous seafood restaurant just a few blocks away. Would you like me to show you the way?A: That would be great! Thank you.B: You're welcome. Let's go now, it's not far.Reading ComprehensionPart 1: Multiple Choice1. A) 6 weeks.2. C) By discussing their viewpoints.3. B) It helps improve blood circulation.4. A) It reduces the risk of heart disease.5. C) Relaxing the mind.Part 2: True or False1. True2. False3. False4. True5. TruePart 3: Matching1. G2. C3. B4. F5. A6. E7. DPart 4: Sentence Completion1. healthy and balanced diet2. practice regular physical exercise3. manage and reduce stress4. get enough sleep5. maintain good mental well-beingWritingExercise 1: Write a short paragraph (40-50 words) about your favorite hobby.My favorite hobby is playing the guitar. I enjoy strumming the strings and creating melodious tunes. It helps me relax and express my emotions. I have been playing for a few years and it brings me a great sense of fulfillment.Exercise 2: Write a short paragraph (40-50 words) explaining the importance of time management.Time management is crucial for success in both personal and professional life. It helps us prioritize tasks, increase productivity, and reduce stress. By effectively planning and organizing our time, we can accomplish more and have a better work-life balance.Note: The above answers are based on standardized material and may vary depending on the specific edition or version of the English textbook "视听说3".。

Keys to the texts of book3Unit OnePart OneExercise 2 :1. Mike C2. Sam E3. .Ted D4. Simon A5. Lilly BExercise 31. avoid; power2. social; outgoing3. reputation;4. despite; wittiest5. make up for; protective6. describe7. perfectionist; critical8. matches9. traits; improved 10. get rid of; characteristicsPart TwoListening IExercise 11 F 2. F 3.T 4. F 5. T 6. TExercise 21. outside world2. at home3.wave hello4. bow5.look straight in the eye6. openly7. look at my feet 8. shy and silentListening IIExercise 11.sensitive; caring2. good friend3.life; people4.leaving ; being awareExercise 21. b2. c3. a4. d5. bPart ThreePractice oneExercise 11. ice-skating2. chemistry3.outgoing;bright; funny4. moody; self-centered5.wavy blond; medium size6. runner-up Exercise 21 T 2. F 3.T 4. F 5. F 6. TPractice TwoExercise 11. 42.collogues3.teacher4. Susan5. BarbaraExercise 21. DEJ2.BF 3CH 4. AGIPractice ThreeWhat kind of people are they?Exercise 11.Pedro energetic2.Mr. Miller patient3.Mr. Smith honest4.Jake stubborn5.Mrs.Duke creativeExercise 21.favourite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoopPractice FourExercise11 F 2. T 3.F 4. F 5. TExercise 21.flattering2.critical3.popular4. reserved5.English Exercise 31.understand the Scots’ English2.the friendliest3.most hospitable4.much nicer5.English courtesy6.no views on the matter/ no commentsPart Four Testing yourselfSection I1.upset2. sensible3. lecture4. calm5. strength6. landed7. waving 8. perfectly 9. wildly 10. beeSection II My history teacher1. b2. b3. d4. b5. d6. a7. c8. bSection III What do you think of yourself?1. secretary2. hardworking3. efficient4. private5. army officer6.help7. fond8. independent9. shy 10. fifteenUnit TwoPart OneExercise 2 :1. C2. E3. D4. B5.AExercise 31.in your hand; used to belong2. practicing with3.talk to each other; why not4. ask for; find a way5. manage to; his own love6. so foolishly jealous7. all three of them8.peadePart TwoListening IExercise 11 B 2.B 3.A 4. B 5. CExercise 21 T 2. F 3.T 4. T 5. F 6. TListening IIExercise 11. a2. a3.b4. c5. cExercise 21. T2. F3.T4. T5. F6.FListening IIIExercise 11. stayed around2. mouse catcher3. rats and mice4. got a paw5. weak and thin6.make a wooden paw7. fastened it8. grow sleek and fat9. managed10. peered out cautiously11. seized it with 12.eighteen micePart ThreePractice oneExercise 11. b2. a3.a4. c5.dExercise 21 F 2. T 3.T 4. F 5. T 6. F 7.F 8. T Practice TwoExercise 11.C DJ2.AEGH 3BFIExercise 21.a2.b3.d4.c5. b6. dPractice ThreeExercise 11. b2.d3.c4. d5.aExercise 21 F 2. T 3.F 4. F 5. F 6. TPractice FourExercise11. b2. c3. b4. a5. d6. a Exercise 21 F 2. F 3.T4. T 5. FPart Four Testing yourselfSection I Little Red Riding Hood1. c2. b3. c4. b5. a6. cSection II Spider, Hare and moon1 T 2. F 3. F 4. F 5. T. 6. F 7. T 8. TSection III The legend of the cowboy1. 18672. shipped3. millionaire4. land5. cattlelion7.cowboys8. camera9. hero 10.adventuresUnit ThreePart OneExercise 2 :1.D2. C3.B4. E5. AExercise 31.T2. F3. T4. T5. T6.T7. F8. F9. T10. FPart TwoListening IExercise 11.b2. C3.d4. aExercise 21 F 2. T 3.F 4. T 5. F 6. TListening IIExercise 11. b2. d3. a4. dExercise 21.30’s2.male3. 1.904.long ; wavy5. heavily built6. light red sweater7. beardListening IIIExercise 11.b2. C3.d4. aExercise 2(1.4.5.7). yesPart ThreePractice oneExercise 11. natural riches2. desert3.extinction4. species5.oxygen6.econimic development7. conservation8. valuable income9. awareness 10. slow downExercise 21 T 2. F 3.F 4.TPractice TwoExercise 11. F2. F3. T4. TExercise 21.south America; pet food; enough protein; develop2.much more;Asia; Africa 3.position; natural resources; gone down; steady 4.continue to rise 5. getting richer and richerPractice ThreeExercise 11.the first few seconds2.so thin3.beings from another planet4.focused on5. looked directly at6. All around7. until now8. despair grief and disgust9. started crying 10. who was sleeping peachfullyExercise 2(1.2.3.5.8) yesPractice FourExercise11 b 2.c 3.a 4.cExercise 21.love2.together3.mother4. house5.school6. friends7. father8.mouth9.beach 10.callPart Four Testing yourselfSection Iplained about2.work3. got out of4.on the ground5. shocked6. cold-blooded killing7. investigation 8. drug dealing 9. common 10. against 11.strong views 12. using drugs 13. too early14. respectable 15 accused ofSection II1. c2. b3. a4. b5. cSection III1. over-crowded cities2. poverty disease3. the drift4. registration5. resentment6. attractive7. education services 8. rural lifeKeys to the texts of book3Unit fourPart OneExercise 2 :puter programmerputer engineering3. internship4. lecture; competitionputer programming skills6. impatient7. constructive8. medical research9. management 10. 3,600 Exercise 3(1.2.4.6.8.9.11.12.) yesPart TwoListening IExercise 1(2.3.4.5.7.) yesExercise 21. weaknesses2. similar abilities and interests; interest us; important and challengingcation ;. promotion; educated persons4.parents ; teachers ; benefit; give careful thought; useful suggestion; personal qualities;5. getting money; our future happiness; combinationListening IIExercise 11.choose their careers2. avoid certain careers3. different professions4. children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignorance1.T2. T3. F4. T5. F6. TPart ThreePractice oneExercise 11 d 2.d 3.a4. bExercise 21.sales manager2. salary3.sales commission4. a car5.travel around in 6. experiences7. university 8. on a teamPractice TwoExercise 11. b2.b3. a4. c5. cExercise 21. 65 words2.90 to 100 words3.with languages; translate letters,answer the phone; foreign visitors ; a second foreign language Practice ThreeExercise 11. c2.a3. b4. d5. bExercise 21. ADF2.BF3. ACEPractice FourExercise12.sensitive; extroverted 2.kids3.doing a good job4. tolerance level5.patientExercise 21 T 2. F 3T 4. F 5. TPart Four Testing yourselfSection I1.100 million2. 35 to 403. 7 to 84. office workers and many professionals5.8:00 ; to 4:006.eight-hour shifts7.Monday; Thursday ; Saturdays ; Sundays8. choose their own working hours; freedom of choice; happy with Section II1.d2. a3. a4. c5. dSection III1. b2. c3. c4. d5. aKeys to the texts of book3Unit FivePart OneExercise 2 :1. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into it3. five times4.individual; group5. sex-specific;; males; females; strangers6. great apes7. teach ; own kind8. raised ; held; look bigger9. round ; tail-wagging10.feeding; every directionListening IExercise 11. plays; real people; real life; emotional problem; loyalty2. public speech; make themselves taller; political ; one-sided3.soft-soap; praise; kindExercise 21 F 2. F 3.T 4. T 5. T 6. TListening IIExercise 11. c2. a3. dExercise 21.be understood easily2.necessary; desirable3.splendid4.prevents;from achieving5. anxiety; effectPart ThreePractice oneExercise 11. d2. a3. b4. a5.bExercise 21 permission ;apply for 2. application form; web site 3.regular mail; fax 4.traveler’s checks; credit cardsPractice Two(2.3.5) yesExercise 21.T2. F3. F4. T5.T.6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian’s Spanish7. English;8. German 9. FrenchPractice ThreeExercise 11. learner; teacher; curriculum2. aptitude; expectations; goals Exercise 21.T2. F3. T4. F5.T.Practice FourExercise11 c 2. c 3.a 4. bExercise 21. eggs and toast2. realistic; goals; far better than; forgetting3. determined; personality .culture4. unusual ; recite aloudPart Four Testing yourselfSection I1. religions2. exist3. 40,0004. cave5. moon6. birth7.records 8. agree 9. by 10. sense 11. ourselves 12.inhabit Section II1. F2. T3. F .4. T5. F6. T7.T8. TSection III1. a2. d3. c4. d5.b6. a。

Keys to the texts of book3Unit sixPart OneExercise 2 :1. d2. a3. b4.c5. c6. aExercise 31. farm animals; hold; feed2. small pets; toys3. buy; toss them out4. real shame5. dangerous; destructive ; bring diseases6. have a points7. humanely; limit8. time; money; warm place9. isolated; company 10. storm of debatePart TwoListening IExercise 11. b2. c3.d4. bExercise 21 T 2. F 3.F 4. F 5. T 6. TListening IIExercise 11.Her son.2. snake; crocodile3.quiet4.picky/particular Exercise 21. big2. dogs3.tiger4. bit5. cat6. friendly 6. eat 8. clear 9.wash 10.space 11. noisy 12. train 13. speak 14.keep 15. quietPart ThreePractice oneExercise 1(1,4,5,6,7,) yesExercise 21 a 2.b 3.c 4.a 5. dPractice TwoExercise 1(1,3)yesExercise 21. for free2.small donation3. 204. hundreds5. eat little6.50 7. animal shots 8. numerous shots 9. diseasesPractice ThreeExercise 11.c2.b3.d4.c5.aExercise 2(2,5.6.7) yesPractice FourExercise11 c 2.c 3. a 4.b 5. dExercise 21.crowding water; grass;2. what is happening; low3.targetpractice; over the area4. gotten rid of; stayPart Four Testing yourselfSection I1.f2. t3. f4. t5. f6. t7. t 8. f 9. f 10. tSection II1. a2. c3. d4. b5. b6. bSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5000 12. embarrassed 13. advertise the furs 14. export bans 15. importation 16.turtleKeys to the texts of book3Unit sevenPart OneExercise 2 :1. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery ;historic interest3. Summer ; too cold4. long history ; vast territory5. feed the monckys6. as many places as possible.7. you name it8.. host city ;ancient civilization; modern architecture9. city wall; treat yourselves 10.express train Part TwoListening IExercise 11 c 2. b 3. b 4. c 5. d 6. aExercise 21. SN 862 17:50 on July 112. SN863 15:10 on July 14 Listening IIExercise 1(B.C.F.G.H.I) yesExercise 2Part one 1.F 2. T 3.T 4.T Part two 1.F 2.F 3T 4.F Part three1.T2.T3.T .4.T5.FPart ThreePractice oneExercise 1Advantages: ADH ; disadvantages: EExercise 21 c 2.d 3.b 4. cPractice TwoExercise 11. seedypany3.shared4. noisy5. early6. private7. booking8. convenient9. restaurant 10.bathroomsExercise 21. T2. F3. T4. T5.6. TPractice ThreeExercise 11. Fuel2. Water3. Vehicles4. ClothesExercise 21.passing lorries 6. self-sufficient2.enough water 7. car repairs3.drinking 8. cost much4.vehicle 9. sweaters5.emergency 10. European winter Practice FourExercise1a. actress Bb. actress and author A1. a2.b3.b4. a5.b6. a7. a8. b Exercise 21.T . F 3. F 4. F 5. F 6. T 7. F 8.TPart Four Testing yourselfSection I1.F2.T3.T4. T5. FSection II My history teacher1. b2. c3. c4. c5. a6. dSection III1. d2. b3.c4. d5. aKeys to the texts of book3Unit eightPart OneExercise 2 :Section A5,7,1,4,6,3,2Section B1)F H I 2)A 3) C E J 4) B D G JExercise 31.passed out; in shock2. back and forth3. knows the reason why4. no doubt; living without her5. plays a great role6. brilliant boy7. very few cases8. deny; nature9. bright or not; should; CAN 10. thicker than; genetic relationship 11. react to; not to mention 12. hard decision; involvedPart TwoListening IExercise 11 F 2. F 3. T 4. F 5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed 8. language 9. young 10. alike 11. separated 12. apart 13. career 14. interestsListening IIExercise 11.b2.d3. a4. dExercise 2(1,4,6,8,10,11,12 ) yesPart ThreePractice oneExercise 1(3,6,9) yesExercise 21. six2. four3.1954. broad5. slim6. extended7. short8. elbows9. knees 10. size-14 11. lungs 12. heartPractice TwoExercise 11. 19212. fit the child3. ordinary schools4. adult conception5. BarbaraExercise 21. good being2.wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction9. scholars 10. scholars 11. street cleanersPractice ThreeExercise 11. c2.b3. c4. bExercise 21 F 2. F 3. T 4. F 5. FPractice FourExercise11 a 2. c 3. d 4. aExercise 21.F2. T3.T4. T5.T6. TPart Four Testing yourselfSection I1.talent2.dancing3.creative4. early5. physical6. energy7. less8. curiosity9. particularly 10. cause 11. fundamental 12. meaning 13. superior 14. fluently 15. read 16. exceptional 17 preparation 18. fullySection II1.F2. T3. F4. F5. T6. F7. F8. TSection III1. c2. a3. c4. b5. dKeys to the texts of book3Unit NinePart OneExercise 2 :1. c2. c E3. .c4. w5. w 6 c 7. c 8. c 9.c 10. w 11. w 12. w 13. c 14. w 15. w 16. c 17. w 18. wExercise 31.prefer; old- fashioned2. as old as3. account for4.own; play; earn a living5. very proud of6. had the chance7. hills; small bridges; singing of birds8. full of energy9. holes; buttons; precise; notes 10.indirectly; individualistic 11. places great importance on 12. a universal languagePart TwoListening IExercise 11 restaurants, airports supermarkets; banks 2. attitudes; in the right mood ; a better feeling; the people around him; happy; work better 3. world war II 4. happy; calm ; a machine; kinds of music ; different times; faster ; slowerExercise 21. T2. F3.F4.T5.T6. F7. T8.FListening IIExercise 11.eases their minds; operations2. classical; instrumental Jazz;folk music 3. reduce tension; 50 male doctors; Mathematics ; 1. quickly 2. calmly 3. chosen for them 4. no music 5. the worst sleepyExercise 21. T2. F3.T4. F5. FPart ThreePractice oneExercise 11. b 19622.d 19633.a 19644. c 1970Exercise 21. their own style2. the nature3. sounds; experimented4. songs; records5. films ; awardsPractice TwoExercise 11. (1) (2) (3)2.(2) (1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the string5. manages the bowExercise 3.1. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice ThreeExercise 11. T2. T3. T4. F5. F6. F7. F8. TExercise 2。

Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly BExercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. T Exercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 T Practice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection II1. B2. B3. D4. B5. D6. A7. C 8. BSection III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond8) independent9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. C Exercise 21. T2. F3. T4. T5. F6. F Listening III Exercise 11) stayed around 2) mouse catcher 3)rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7.F 8.TPractice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. D Practice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. A Exercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7.F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction4) species5) oxygen 6) economic 7) conservation8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa￥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. F Exercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. B Exercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.T Exercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by10. sense11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. A Exercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debate Part TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particularExercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.D Exercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory10. reduced11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. A Exercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages E Exercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking 8. convenient 9. restaurants 10. bathroomsExercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7)A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. D Section III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5，7，1，4，6，3，2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.T Part Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16.C 17. W 18.WExercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slowerExercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makesthe notes4. on the strings5. manages the bow Exercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. TExercise 2Bruce Springsteen: communicative, direct, exciting, simplerSting: naturalPeter Gabriel：musicalBranford Marsalis: brilliant, humorous Youssou N’Dour：not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damaged Exercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days 8. give up 9. stop trying10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. A Section II 1. C 2. B 3. D 4.A 5. B Section III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black11. white 12. shaking 13. wet 14. sweet15. delicious16. angel 17. grave 18. nights 19. days 20. taste。

新编大学英语3视听说教程答案【篇一：新编大学英语视听说3纯答案版】t oneexe 2 d c b e aexe 3 t f t t t t f f t fpart twolistening iexe 1 bcda exe 2 ftftftlistening iiexe 1 bdadexe 2 30s, male, 1.90, long wavy, heavy built, light red sweater, beardlistening iiiexe 1 bcda exe 2 1, 4, 5, 7part threepractice oneexe 1 1) natural riches, 2) desert, 3) extinction, 4) species, 5) oxygen, 6) economic development, 7) conservation, 8) valuable income, 9) awareness, 10) slow downexe 2 tfftpractice twoexe 1 ffttexe 2 1) south america, pet food, enough protein, develop2) much more, asia, africa3) position, natural resources, gone down, steady4) continued to rise5) getting richer and richerpractice threeexe 11) the few seconds, 2) so thin, 3) beings from another planet, 4) focused on, 5) looked directly at, 6) all around, 7)until now, 8) despair grief and disgust, 9) started crying, 10) who was sleeping peacefully exe 2 1,2,3,5,8practice fourexe 1 bcacexe 2 love, together, mother, house, school, friends, father, month, beach, callpart foursection icomplained about, work, got out of, on the ground, shocked, cold-blooded killing, investigation, drug dealing, concern, against, strong views, using drugs, too early, respectable, accused ofsection ii cbabcsection iii 1) overcrowded cities, 2) poverty, disease, 3) the drift, 4) registration, 5) resentment, 6) attractive, 7) education services, 8) rural lifeunit 4part oneexe 2 1) computer programmer, 2) computer engineering, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical, 9) management, 10) 3600 exe 3 1,2,4,6,8,9,11,12part twolistening iexe 12,3,4,5,7exe 2 1)weaknesses, 2) similar abilities and interest, interest us, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combination listening iiexe 11) choose their careers, 2) avoid certain careers3) different professions, 4) children’s impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance exe 2 ttftftpart threepractice oneexe 1 ddabexe 2 sales manager, salary, sales commission, a car, travel round in, experience, university, on a team practice twoexe 1 bbaccexe 2 1) 65 words, 2)90 to 100 words, 3) with languages, translate letters, answer the phone, foreign visitors, second foreign languagepractice threeexe 1 cabdbexe 2 1) adf 2) bf 3) acepractice fourexe 1 1) sensitive extroverted, 2) kids, 3) doing a good job, 4) tolerance level, 5) patientexe 2tftftpart foursection i1. 100 million2. 35 to 403. 7 to 84. office workers, many professionals5. 8:00 to 4:006. eight-hour shifts7. monday, thursday, saturday, sundays8. choose their own working hours, freedom of choice, happy withsection ii daacdsection iii bccdaunit 5part oneexe 2 bacedfexe 31. over long distances2. look into it3. five times4. individual, group【篇二：新编大学英语视听说教程3 浙江大学(第二版)听力完整答案】t oneexercise 21. mike c2. sam e3. ted d4. simon a5. lillyb exercise 31. avoid power2. socialoutgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches9. traits improved10. get rid of characteristicspart twolistening iexercise 11. f2. f3. t4. f5. t6. texercise 21) outside world2) at home 3) wave hello 4) bow5) look straight in the eyes of6) openly7) look at my feet 8) shy and silentlistening iiexercise 11. sensitive/ caring independent / understanding2. good friend3. lifepeople4. learning being awareexercise 21. b2. c3. a4. d5. bpart threemore listeningpractice oneexercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blondmedium height6. unner-upexercise 21. t2. f3. t4. f5. f 6 tpractice twoexercise 11. four2. colleagues3. teacher4. susan5. barbara\exercise 21) paul d e j 2) susan b f3) maria c h4) peter a g ipractice three exercise 11. pedroenergetic2. mr. miller patient3. mr. smithhonest4. jake stubborn5. mrs. duke creativepractice fourexercise 11) f 2) t 3) f 4) f 5) texercise 21) flattering 2) critical3) popular4) reserved 5) english part fourtesting yourselfsection 11) upset2) sensible3) lecture 4) calm 5) strength6) landed 7) waving8) perfectly 9) wildly 10) beesection ii1. b2. b3. d4. b5. d6. a7. c8. bsection iii1) secretary 2) hard-working3) efficient 4) private5) army officer 6) help7) fond 8) independent9) shy10) fifteenunit 2part oneexercise 21. c2. b3. d4. b5.aexercise 31. in your handused to belong to2. practicing with3. talked to each other why not4. ask forfind a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacepart twolistening iexercise 11. b2. b3. a4. b5. cexercise 21. t2. f3. t4. t5. f6. tlistening iiexercise 11. a2. a3. b4. c5. cexercise 21. t2. f3. t4. t5. f6. flistening iiiexercise 11) stayed around 2) mouse catcher3) rats and mice4) got a paw 5) weak and thin6) make a wooden paw7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with12) eighteen mice part threemore listeningpractice oneexercise 11. b2. a3. a4. c5. dexercise 21. f2.t3. t4. f5.t 6 f 7. f 8.tpractice twoexercise 11. c d j2. a e g h3. b f iexercise 21. a2 .b3. d4.c 5. b6. dpractice three exercise 11. b2. d3. c4. d5. aexercise 21. f2. t3. f4. f5.f6. tpractice fourexercise 11. b2 . c3. b4. a5. d6. aexercise 21. f2. f3. t4. t5.fpart fourtesting yourselfsection 11. c2 . b3. c 4. b5. a6. csection ii1. t2. f3. f4. f5.t6. f7. t8. tsection iii1.18672. shipped ( if these cattle could be brought to abilene, they could be put on trains and shipped to cities in the north and east.)【篇三：新编大学英语视听说教程一册(最新第三版)一至六单元答案】t 1 1．1-5 ftftt2. 1-5 776-2235，65, 11，loud, quieter 1. 1-5 abbda2. 1-5 old, torn/ blue, by the hand, holiday, children 1.1-5 181st，very tired, take hold of; for her trouble, never/ again 1.1-5cdbdb2.. r: fulfills my every need./stay home, cook, clean, and watch the kids.e: open-minded/ something interesting to say.part 21. acdegij2. 1-8 in a mess, my turn, a hand, work on, expectations of,how about, too much, what we havepart 31. 1)-15) nicer, excited, promises, married, first, lasted, kids, enough, changes, loves, mad, care about, boy friend, get better, helppart 4 1. cefgkl2. 1-5 personality/ background, good sense of humor, terrible, different environments, looks 1. 1-5 ftftt2. 1-5 gone by, no sign, taken over, enough, limits 1. 1-5 tfftt2. 1-5 seventies, selfish, unnatural, husband, surrounded 1. 1-5 abdcd2. c: done his part of the houseworkh: high priority withw: responsibilityunit 2part 1 1. 1-5 tftft2. 1 he moved to newton.2 she wrote down the new address on it.3 it was thrown away. / the professor threw it away.4 the professor’s daughter. 1. 1-5 tffft2. 1)-12) far, away, lucky, forget, parked, over, route, miss, smile, drove, laughter, usual 1. 1-5 fttff2. abd/ fgi 1. 1 it’s about some ways of helping peop le improve their memory.2 she’s a communications trainer who teachers memory skills.3 record, retain and retrieve.4 using very intense visual images.2. 1 1)-4) records, figure out, organize, filing system,2 5)-9) elaborate, broken up, see, loudly, forgetpart 21. 1 4 6 72. 1-8 turn in, worry about, growing up, gone, on the right side, last night, turned out tobe, take/ off, lately, fixing for, made a mistake, turn onpart 31. 1 he is a 25-year-old italian, who has an exceptional memory.2 he is demonstrating the art of memory.3 how, where and why information is stored.4 when he was 11 years old.5 determination. / hard work and exercise.2. 1-7 randomly, repeats them, backwards, recall every detail/a year old, more forgetful families, heredity/ environment, the brain/ specific genes, a vacation/ a regular guy part 4 1. 1-5 ftftt 2. 1 the night before they left home.2 he questioned his wife about the things she had packed.3 on top of the piano. 1. 1-3 bca2.1 3 4 6 1. cbdaa2.1—c 2—a 3—b 1. bdf2. 1-6 her grandmother, a small area, a better sense, three or four, by smell, soap/ perfume uint3part11. w: french, the united states, mushrooms, umbrellam: german, spain, milk, bullfight ticket2. 1-5 t t t f f 1. 1-4 lecture, teller, give a lecture, never even smiled, exhausted2. 1-5 c a b a b 1. 1 4 62. a-e love, unity, purity, happiness, desire,6-8 yellow rose, yellow tulip, carnation 1. 1-5 f t f t t2. 1-4 husband, made a awful mistake, full of love, for wordspart 21. 1-9 f f t t f t t t t2. 1-8 lack communication skills, take the initiative, first thing, becoming boring, non-verbal language, facial expression, annoying, elsewhere, change for the betterpart 31. 1 eyes, face, head, shoulders and hands.2 she prefers barack’s.3 intensity.4 i’m a fighter!5 relaxed.2. 1)-12) examine, slight, intensity, contrast, relaxed, simplicity, confidence,negotiation, cool, information, resolution, passion.part 4 1. 1-8 c a b c a b a c 1 his left eye.2 a special kind of wood.3 his wooden eye.4 a less attractive girl.5 she had a particularly big nose.6 would you like to dance?7 excited.8 would i? would i?9 angry and hurt.10 wood eye. 1．1-8 make their space, spread your towels, coat/ small bag, library,one corner/ chair, across from/ briefcase, stiffened/ head, invaded2. 1-6 f f t t t f1. 1 intimate, personal, social, and public.2 culture.2. b a c dunit 4part1 1. 1-5 a c c a c2. 1-5 t f t f f 1.1-6 t f t t f t2. 1-7 this semester, need to know, different, the rules/ use, do our homework, reading about, questions/ answers 1. 2 3 1 4 5 62. 1-10 history, major, not, 2009, 2010, title, computer, out, shelf, reserve 1. 1-5 a c b b a2. g: competed, sang, laughed, children,ln: turn, next,lv: acting them out,lo: demonstrated, clapping our hands, posters, cards,ldv: stories, lay, shut, musicpart 21. 1-10 t f t f f f t t f t2. 1-10 what can i do, like sports, under construction, schoolwork, more about him, quit school, the tuition fee, in a rush, student loans, student centerpart31. 1-10 disaster, picture, totally, unbelievable, review, consider, particular,independently-minded, medicine, worthpart 4 1. 1-5 a b c a d2. 1-5 t t t f f1. 1-5 b c a a c1. 1-7 b c b c b a b1. 1-7 activity, information, writing, different, skills, position, involves,8 you cannot possibly discover all that you need to know at once.9 don’t be discouraged if your work is not p erfect at first.10 you should expect progress, not perfection, from yourselfunit 5part11. 42312. 1-10 cold, red, thick, warm, small, use, finished, middle, covered, rabbits 1. 1 it took place in laos.2 a buffalo.4 because the farmer was very intelligent.5 he said he was afraid the tiger might kill his buffalo when he was gone.6 he took his plow and hit the tiger.2 1-5 ftftf 1. 125792. 1 in the early hours yesterday.2 sleeping.3 in the games room.4 a lit cigarette end.5 because smoking is forbidden in the games room. 1. 1-5 badcb2. 1-5 living species, international/ reached, less demand/used to, organizations, atlantic/ pacificpart 21. acdfh2. 1-8 for generations/ well-known, came across, a pair of, black/ small, happen to, in the audience/ call on, became aware, further study/ types ofpart 31. 1-10 dictionaries, garden, forest, signals, 135, energy, move, across, logging, remaining2. 1)-10) tough, devised, rubs, fatten, hibernate, flexible, grasp, monkey, cigarpart 4 1. 1 he was a waiter.2 on a beach.3 for a short time.4 a dog.5 a sea lion.2. 1-5 up/ down, struggling, jumped through, came by, puzzled.1. 1-6 fttftf2. 1 a monkey, an ox and an elephant.2 because they are frightened.3 he takes hold of the lion, knocks it against the tree and stamps on the lion.4 in order to show he is the most powerful.5 the lion still does not understand why the elephant did that.。